Overview

  • Product name

    Recombinant Human RASSF1 protein (denatured)
  • Protein length

    Full length protein
  • Description

    Recombinant Human RASSF1 protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMSGEPELIELRELA PAGRAGKGRTRLERANALRIARGTACNPTRQLVPGRGHRFQPAGPATHTW CDLCGDFIWGVVRKGLQCAHCKFTCHYRCRALVCLDCCGPRDLGWEPAVE RDTNVDEPVEWETPDLSQAEIEQKIKEYNAQINSNLFMSLNKDGSYTGFI KVQLKLVRPVSVPSSKKPPSLQDARRGPGRGTSVRRRTSFYLPKDAVKHL HVLSRTRAREVIEALLRKFLVVDDPRKFALFERAERHGQVYLRKLLDDEQ PLRLRLLAGPSDKALSFVLKENDSGEVNWDAFSMPELHNFLRILQREEEE HLRQILQKYSYCRQKIQEALHACPLG
    • Molecular weight

      43 kDa including tags
    • Amino acids

      1 to 340
    • Tags

      His-DDDDK tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab137136 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 85 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 2.4% Urea, 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names

    • 123F2
    • Cardiac specific ras association domain family 1 protein
    • cardiac-specific ras association domain family 1 protein, 123F2
    • NORE2A
    • OTTHUMP00000195503
    • OTTHUMP00000195504
    • OTTHUMP00000195505
    • OTTHUMP00000195507
    • Pancreas specific ras association domain family 1 protein
    • Ras association (RalGDS/AF 6) domain family member 1
    • Ras association domain-containing protein 1
    • RASF1_HUMAN
    • Rassf1
    • RASSF1A
    • RDA32
    • REH3P21
    • Tumor suppressor protein RDA32
    • WUGSC:H_LUCA12.5
    see all
  • Function

    Potential tumor suppressor. Required for death receptor-dependent apoptosis. Mediates activation of STK4 during Fas-induced apoptosis. When associated with MOAP1, promotes BAX conformational change and translocation to mitochondrial membranes in response to TNF and TNFSF10 stimulation. Isoform A interacts with CDC20, an activator of the anaphase-promoting complex, APC, resulting in the inhibition of APC activity and mitotic progression. Inhibits proliferation by negatively regulating cell cycle progression at the level of G1/S-phase transition by regulating accumulation of cyclin D1 protein. Isoform C has been shown not to perform these roles, no function has been identified for this isoform. Isoform A disrupts interactions among MDM2, DAXX and USP7, thus contributing to the efficient activation of TP53 by promoting MDM2 self-ubiquitination in cell-cycle checkpoint control in response to DNA damage.
  • Tissue specificity

    Isoform A and isoform C are ubiquitously expressed in all tissues tested, however isoform A is absent in many corresponding cancer cell lines. Isoform B is mainly expressed in hematopoietic cells.
  • Sequence similarities

    Contains 1 phorbol-ester/DAG-type zinc finger.
    Contains 1 Ras-associating domain.
    Contains 1 SARAH domain.
  • Cellular localization

    Nucleus. Predominantly nuclear and Cytoplasm > cytoskeleton. Cytoplasm > cytoskeleton > centrosome. Cytoplasm > cytoskeleton > spindle. Cytoplasm > cytoskeleton > spindle pole. Nucleus. Localizes to cytoplasmic microtubules during interphase, to bipolar centrosomes associated with microtubules during prophase, to spindle fibers and spindle poles at metaphase and anaphase, to the midzone during early telophase, and to the midbody in late telophase in cells. Colocalizes with MDM2 in the nucleus.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab137136.

References

ab137136 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab137136.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up