Overview

  • Product name

    Recombinant Human RASSF2 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MDYSHQTSLVPCGQDKYISKNELLLHLKTYNLYYEGQNLQLRHREEEDEF IVEGLLNISWGLRRPIRLQMQDDNERIRPPPSSSSWHSGCNLGAQGTTLK PLTVPKVQISEVDAPPEGDQMPSSTDSRGLKPLQEDTPQLMRTRSDVGVR RRGNVRTPSDQRRIRRHRFSINGHFYNHKTSVFTPAYGSVTNVRINSTMT TPQVLKLLLNKFKIENSAEEFALYVVHTSGEKQKLKATDYPLIARILQGP CEQISKVFLMEKDQVEEVTYDVAQYIKFEMPVLKSFIQKLQEEEDREVKK LMRKYTVLRLMIRQRLEEIAETPATI
    • Amino acids

      1 to 326
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160647 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CENP 34
    • Centromere protein 34
    • Ras association (RalGDS/AF 6) domain family 2
    • Ras association (RalGDS/AF-6) domain family member 2
    • Ras association domain containing protein 2
    • Ras association domain-containing protein 2
    • RASF2_HUMAN
    • RASFADIN
    • RASSF2
    • RP4-599I11.1
    see all
  • Function

    Potential tumor suppressor. Acts as a KRAS-specific effector protein. May promote apoptosis and cell cycle arrest.
  • Tissue specificity

    Widely expressed with highest levels in brain, placenta, peripheral blood and lung. Frequently down-regulated in lung tumor cell lines.
  • Sequence similarities

    Contains 1 Ras-associating domain.
    Contains 1 SARAH domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab160647 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160647 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160647.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up