Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MTVDSSMSSGYCSLDEELEDCFFTAKTTFFRNAQSKHLSKNVCKPVEETQ RPPTLQEIKQKIDSYNTREKNCLGMKLSEDGTYTGFIKVHLKLRRPVTVP AGIRPQSIYDAIKEVNLAATTDKRTSFYLPLDAIKQLHISSTTTVSEVIQ GLLKKFMVVDNPQKFALFKRIHKDGQVLFQKLSIADRPLYLRLLAGPDTE VLSFVLKENETGEVEWDAFSIPELQNFLTILEKEEQDKIQQVQKKYDKFR QKLEEALRESQGKPG
    • Molecular weight

      57 kDa including tags
    • Amino acids

      1 to 265

Specifications

Our Abpromise guarantee covers the use of ab132178 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Maxp 1
    • MAXP1
    • MGC10823
    • MGC17344
    • New ras effector 1
    • NORE 1
    • NORE1
    • NORE1A
    • NORE1B
    • Novel Ras effector 1
    • RAP1 Binding Protein
    • RAPL
    • Ras association (RalGDS/AF 6) domain family 5
    • Ras association (RalGDS/AF 6) domain family member 5
    • Ras association domain containing family protein 5
    • Ras association domain-containing protein 5
    • Ras effector like protein
    • RASF5_HUMAN
    • RASSF 3
    • RASSF 5
    • RASSF3
    • RASSF5
    • Regulator for cell adhesion and polarization enriched in lymphoid tissue
    • Regulator for cell adhesion and polarization enriched in lymphoid tissues
    • Tumor suppressor RASSF3
    see all
  • Function

    Potential tumor suppressor. Seems to be involved in lymphocyte adhesion by linking RAP1A activation upon T cell receptor or chemokine stimulation to integrin activation. Isoform 2 stimulates lymphocyte polarization and the patch-like distribution of ITGAL/LFA-1, resulting in an enhanced adhesion to ICAM1. Together with RAP1A may participate in regulation of microtubule growth. The association of isoform 2 with activated RAP1A is required for directional movement of endothelial cells during wound healing. May be involved in regulation of Ras apoptotic function. The RASSF5-STK4 complex may mediate HRAS1 and KRAS induced apoptosis.
  • Tissue specificity

    Widely expressed. Frequently down-regulated in lung tumor cell lines and primary lung tumors.
  • Sequence similarities

    Contains 1 phorbol-ester/DAG-type zinc finger.
    Contains 1 Ras-associating domain.
    Contains 1 SARAH domain.
  • Cellular localization

    Cytoplasm. Cytoplasm > cytoskeleton. Isoform 2 is mainly located in the perinuclear region of unstimulated primary T cells. Upon stimulation translocates to the leading edge and colocalizes with ITGAL/LFA-1 in the peripheral zone of the immunological synapse. Isoform 2 is localized to growing microtubules in vascular endothelial cells and is dissociated from microtubules by activated RAP1A.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132178 stained with Coomassie Blue.

References

ab132178 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132178.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up