For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online
United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Customized Products & Partnerships
    Customized Products & Partnerships

    Customized products and commercial partnerships to accelerate your diagnostic and therapeutic programs.

    Customized products

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    recombinant-human-rb-protein-ab83205.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Cell Biology Cell Cycle Cell Cycle Inhibitors Rb
Share by email

Recombinant Human Rb protein (ab83205)

  • Datasheet
Submit a review Q&A (3)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Shipping info

Promotion Information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

SDS-PAGE - Recombinant Human Rb protein (ab83205)
  • Western blot - Recombinant Human Rb protein (ab83205)

Key features and details

  • Expression system: Baculovirus
  • Purity: > 95% SDS-PAGE
  • Tags: His tag N-Terminus
  • Suitable for: SDS-PAGE, GSA, WB

You may also be interested in

Preparation
Product image
Immunoprecipitation kit (ab206996)
Protein
Product image
Recombinant Human STAT3 protein (ab43618)
Primary
Product image
Anti-NEDD8 antibody [Y297] (ab81264)

View more associated products

Description

  • Product name

    Recombinant Human Rb protein
    See all Rb proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    Purified by affinity and FPLC chromatography.
  • Expression system

    Baculovirus
  • Accession

    NM_000321
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MPPKTPRKTAATAAAAAAEPPAPPPPPPPEEDPEQDSGPEDLPLVRLEFE ETEEPDFTALCQKLKIPDHVRERAWLTWEKVSSVDGVLGGYIQKKKELWG ICIFIAAVDLDEMSFTFTELQKNIEISVHKFFNLLKEIDTSTKVDNAMSR LLKKYDVLFALFSKLERTCELIYLTQPSSSISTEINSALVLKVSWITFLL AKGEVLQMEDDLVISFQLMLCVLDYFIKLSPPMLLKEPYKTAVIPINGSP RTPRRGQNRSARIAKQLENDTRIIEVLCKEHECNIDEVKNVYFKNFIPFM NSLGLVTSNGLPEVENLSKRYEEIYLKNKDLDARLFLDHDKTLQTDSIDS FETQRTPRKSNLDEEVNVIPPHTPVRTVMNTIQQLMMILNSASDQPSENL ISYFNNCTVNPKESILKRVKDIGYIFKEKFAKAVGQGCVEIGSQRYKLGV RLYYRVMESMLKSEEERLSIQNFSKLLNDNIFHMSLLACALEVVMATYSR STSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEGNLTREMIKHL ERCEHRIMESLAWLSDSPLFDLIKQSKDREGPTDHLESACPLNLPLQNNH TAADMYLSPVRSPKKKGSTTRVNSTANAETQATSAFQTQKPLKSTSLSLF YKKVYRLAYLRLNTLCERLLSEHPELEHIIWTLFQHTLQNEYELMRDRHL DQIMMCSMYGICKVKNIDLKFKIIVTAYKDLPHAVQETFKRVLIKEEEYD SIIVFYNSVFMQRLKTNILQYASTRPPTLSPIPHIPRSPYKFPSSPLRIP GGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFGTSEKFQKINQ MVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQK LAEMTSTRTRMQKQKMNDSMDTSNKEEK
    • Predicted molecular weight

      108 kDa
    • Amino acids

      1 to 928
    • Tags

      His tag N-Terminus

Associated products

  • Related Products

    • Anti-6X His tag® antibody [HIS.H8] (ab18184)
    • Anti-6X His tag® antibody [4D11] (ab5000)

Specifications

Our Abpromise guarantee covers the use of ab83205 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Gel Supershift Assays

    Western blot

    EMSA

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.9
    Constituents: 0.0154% DTT, 0.316% Tris HCl, 0.00584% EDTA, 20% Glycerol (glycerin, glycerine)

General Info

  • Alternative names

    • Exon 17 tumor GOS561 substitution mutation causes premature stop
    • GOS563 exon 17 substitution mutation causes premature stop
    • OSRC
    • Osteosarcoma
    • p105-Rb
    • P105RB
    • PP105
    • pp110
    • PPP1R130
    • pRb
    • Prepro retinoblastoma associated protein
    • Protein phosphatase 1 regulatory subunit 130
    • Rb
    • RB transcriptional corepressor 1
    • RB_HUMAN
    • RB1
    • RB1 gene
    • Retinoblastoma 1
    • Retinoblastoma suspectibility protein
    • Retinoblastoma-associated protein
    see all
  • Function

    Key regulator of entry into cell division that acts as a tumor suppressor. Promotes G0-G1 transition when phosphorylated by CDK3/cyclin-C. Acts as a transcription repressor of E2F1 target genes. The underphosphorylated, active form of RB1 interacts with E2F1 and represses its transcription activity, leading to cell cycle arrest. Directly involved in heterochromatin formation by maintaining overall chromatin structure and, in particular, that of constitutive heterochromatin by stabilizing histone methylation. Recruits and targets histone methyltransferases SUV39H1, KMT5B and KMT5C, leading to epigenetic transcriptional repression. Controls histone H4 'Lys-20' trimethylation. Inhibits the intrinsic kinase activity of TAF1. Mediates transcriptional repression by SMARCA4/BRG1 by recruiting a histone deacetylase (HDAC) complex to the c-FOS promoter. In resting neurons, transcription of the c-FOS promoter is inhibited by BRG1-dependent recruitment of a phospho-RB1-HDAC1 repressor complex. Upon calcium influx, RB1 is dephosphorylated by calcineurin, which leads to release of the repressor complex (By similarity). In case of viral infections, interactions with SV40 large T antigen, HPV E7 protein or adenovirus E1A protein induce the disassembly of RB1-E2F1 complex thereby disrupting RB1's activity.
  • Tissue specificity

    Expressed in the retina.
  • Involvement in disease

    Childhood cancer retinoblastoma
    Bladder cancer
    Osteogenic sarcoma
  • Sequence similarities

    Belongs to the retinoblastoma protein (RB) family.
  • Domain

    The Pocket domain binds to the threonine-phosphorylated domain C, thereby preventing interaction with heterodimeric E2F/DP transcription factor complexes.
  • Post-translational
    modifications

    Phosphorylated by CDK6 and CDK4, and subsequently by CDK2 at Ser-567 in G1, thereby releasing E2F1 which is then able to activate cell growth. Dephosphorylated at the late M phase. SV40 large T antigen, HPV E7 and adenovirus E1A bind to the underphosphorylated, active form of pRb. Phosphorylation at Thr-821 and Thr-826 promotes interaction between the C-terminal domain C and the Pocket domain, and thereby inhibits interactions with heterodimeric E2F/DP transcription factor complexes. Dephosphorylated at Ser-795 by calcineruin upon calcium stimulation. CDK3/cyclin-C-mediated phosphorylation at Ser-807 and Ser-811 is required for G0-G1 transition. Phosphorylated by CDK1 and CDK2 upon TGFB1-mediated apoptosis.
    N-terminus is methylated by METTL11A/NTM1 (By similarity). Monomethylation at Lys-810 by SMYD2 enhances phosphorylation at Ser-807 and Ser-811, and promotes cell cycle progression. Monomethylation at Lys-860 by SMYD2 promotes interaction with L3MBTL1.
    Acetylation at Lys-873 and Lys-874 regulates subcellular localization, at least during keratinocytes differentiation.
  • Cellular localization

    Nucleus.
  • Target information above from: UniProt accession P06400 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Images

  • SDS-PAGE - Recombinant Human Rb protein (ab83205)
    SDS-PAGE - Recombinant Human Rb protein (ab83205)
  • Western blot - Recombinant Human Rb protein (ab83205)
    Western blot - Recombinant Human Rb protein (ab83205)

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

  • Datasheet download

    Download

References (0)

Publishing research using ab83205? Please let us know so that we can cite the reference in this datasheet.

ab83205 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

1-3 of 3 Abreviews or Q&A

Question

Re: Reply from Abcam to your enquiry regarding ab83205 [CCE3194263] Thanks! If I could get a copy of the image it would be great. I used the purified Rb from abcam for a DNAse I protection assay. Rb doesn’t associate to DNA on its own, it requires interaction with proteins like E2Fs or SP1. So with my DNAse I protection assay I expected to see no protection when incubated with purified Rb (ie Rb without any other protein contanminants). Surprisingly I saw a precise protection pattern similar to that I observed upon incubation with SP1 which puzzled me. So that’s when I emailed abcam to determine if there were any other proteins with the purified Rb. Rb’s interaction with E2Fs and SP1 is very strong therefore based on my results I thought that there may be some contamination of either of these proteins in the purified Rb mixture. Hope this helps let me know if you need anymore info. Thanks

Read More

Abcam community

Verified customer

Asked on Oct 10 2011

Answer

Thanks for your reply. I have arranged for the lab to send a free of charge vial from the new lot, which should arrive in the next few days. Please see attached for the SDS-PAGE and Western blot images of the new lot of Rb protein. In regards to where the contaminating bands were seen in the previous lots, I received this reply: "Regarding the extra bands' MW, 3 weak bands are seen between 66 and 97 kDa markers and one in between 45 and 66 kDa". The lab has also asked if you could send any data from your transcription assay for their analysis. Please let me know if you have any questions, and I will update you shortly with an expected arrival data for the new vial of ab83205.

Read More

Abcam Scientific Support

Answered on Oct 10 2011

Question

Hi, Thanks for your reply that explains a lot. Could you please tell me the sizes of the bands you see? I would truly appreciate if you could send a vial of the new lot with which I can repeat my experiments. Thanks

Read More

Abcam community

Verified customer

Asked on Oct 07 2011

Answer

Thank you for your reply. I will ask the lab for details about the bands that they saw. I have not seen an image myself. For our records, can you tell me what kind of results you obtained with this protein in your transcription assay? I will have a new vial sent to you as soon as possible. I look forward to hearing from you.

Read More

Abcam Scientific Support

Answered on Oct 07 2011

Question

Hi I would like to know if there are any contaminating proteins in ab83205?

Read More

Abcam community

Verified customer

Asked on Oct 07 2011

Answer

Thank you for your phone call last month and for your patience while the lab has tested this protein. The lab tested the current lots of the protein and found that there were 3-4 light contaminant bands below the pRB (apparent Mw 107 kDa). The identities of these bands are unknown. The lab has just produced a new lot and removed most of the contaminating bands. If you are still interested, please let me know and I will get a vial of this new lot for you. Let me know if you have any questions, or if there is anything else that we can do for you.

Read More

Abcam Scientific Support

Answered on Oct 07 2011

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Get resources and offers direct to your inbox Sign up
A-Z by research area
  • Cancer
  • Cardiovascular
  • Cell biology
  • Developmental biology
  • Epigenetics & Nuclear signaling
  • Immunology
  • Metabolism
  • Microbiology
  • Neuroscience
  • Signal transduction
  • Stem cells
A-Z by product type
  • Primary antibodies
  • Secondary antibodies
  • Biochemicals
  • Isotype controls
  • Flow cytometry multi-color selector
  • Kits
  • Loading controls
  • Lysates
  • Peptides
  • Proteins
  • Slides
  • Tags and cell markers
  • Tools & Reagents
Help & support
  • Support
  • Make an Inquiry
  • Protocols & troubleshooting
  • Placing an order
  • RabMAb products
  • Biochemical product FAQs
  • Training
  • Browse by Target
Company
  • Corporate site
  • Investor relations
  • Company news
  • Careers
  • About us
  • Blog
Events
  • Tradeshows
  • Conferences
International websites
  • abcam.cn
  • abcam.co.jp

Join with us

  • LinkedIn
  • facebook
  • Twitter
  • YouTube
  • Terms of sale
  • Website terms of use
  • Cookie policy
  • Privacy policy
  • Legal
  • Modern slavery statement
© 1998-2022 Abcam plc. All rights reserved.