Description

  • Product name

    Recombinant Human RbAp48 protein
    See all RbAp48 proteins and peptides
  • Expression system

    Escherichia coli
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWL PDVTRPEGKDF SIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHY DSEKGEFGGFGSVSGKIEIEIKIN HEGEVNRARYMPQNPCIIATKTPS SDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGL SWNPNLSGHLL SASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFG SVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATG SADKTVALWDLRN LKLKLHSFESHKDEIFQVQWSPHNETILASSGTDR RLNVWDLSKIGEEQSPEDAEDGPPEL LFIHGGHTAKISDFSWNPNEPW VICSVSEDNIMQVWQMAENIYN
    • Amino acids

      1 to 410

Specifications

Our Abpromise guarantee covers the use of ab93983 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

    Protein Identity confirmed by Mass Spectrometry (MS/MS) (acquired on initial reference batch)
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C.

    pH: 4.50
    Constituents: 0.5% Trehalose, 36% Urea, 1.64% Sodium phosphate, 0.058% Sodium chloride

  • Reconstitution
    Reconstitute with 77 µl aqua dest.

General Info

  • Alternative names

    • CAF I p48
    • CAF-1 subunit C
    • CAF-I 48 kDa subunit
    • CAF-I p48
    • Chromatin assembly factor 1 subunit C
    • Chromatin assembly factor I p48 subunit
    • Chromatin assembly factor/CAF 1 p48 subunit
    • Histone-binding protein RBBP4
    • MSI1 protein homolog
    • Nucleosome-remodeling factor subunit RBAP48
    • NURF55
    • RB binding protein 4 chromatin remodeling factor
    • RbAp 48
    • RBAP48
    • RBBP-4
    • RBBP4
    • RBBP4_HUMAN
    • Retinoblastoma binding protein 4
    • Retinoblastoma binding protein p48
    • Retinoblastoma-binding protein 4
    • Retinoblastoma-binding protein p48
    see all
  • Function

    Core histone-binding subunit that may target chromatin assembly factors, chromatin remodeling factors and histone deacetylases to their histone substrates in a manner that is regulated by nucleosomal DNA. Component of several complexes which regulate chromatin metabolism. These include the chromatin assembly factor 1 (CAF-1) complex, which is required for chromatin assembly following DNA replication and DNA repair; the core histone deacetylase (HDAC) complex, which promotes histone deacetylation and consequent transcriptional repression; the nucleosome remodeling and histone deacetylase complex (the NuRD complex), which promotes transcriptional repression by histone deacetylation and nucleosome remodeling; the PRC2/EED-EZH2 complex, which promotes repression of homeotic genes during development; and the NURF (nucleosome remodeling factor) complex.
  • Sequence similarities

    Belongs to the WD repeat RBAP46/RBAP48/MSI1 family.
    Contains 6 WD repeats.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • The image shows an electrophoretic assay performed using an Agilent 5100 ALP. In some images coloured control bands can be seen at 15 kDa (green) and/or 240 kDa (purple). The protein-specific band is blue.

References

ab93983 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab93983.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up