Description

  • Product name

    Recombinant Human RbAp48 protein (Tagged-His Tag)
    See all RbAp48 proteins and peptides
  • Purity

    >= 46 % SDS-PAGE.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLP DVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSE KGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLV FDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHT ICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHE SLFGSVADD QKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVA LWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSK IGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIM QVWQMAENIYNDEDPEGSVDPEGQGS
    • Predicted molecular weight

      48 kDa including tags
    • Amino acids

      2 to 425
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Genbank accession number: NM_005610

Specifications

Our Abpromise guarantee covers the use of ab196431 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.0
    Preservative: 1.36% Imidazole
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.05% DTT, 20% Glycerol

General Info

  • Alternative names

    • CAF I p48
    • CAF-1 subunit C
    • CAF-I 48 kDa subunit
    • CAF-I p48
    • Chromatin assembly factor 1 subunit C
    • Chromatin assembly factor I p48 subunit
    • Chromatin assembly factor/CAF 1 p48 subunit
    • Histone-binding protein RBBP4
    • MSI1 protein homolog
    • Nucleosome-remodeling factor subunit RBAP48
    • NURF55
    • RB binding protein 4 chromatin remodeling factor
    • RbAp 48
    • RBAP48
    • RBBP-4
    • RBBP4
    • RBBP4_HUMAN
    • Retinoblastoma binding protein 4
    • Retinoblastoma binding protein p48
    • Retinoblastoma-binding protein 4
    • Retinoblastoma-binding protein p48
    see all
  • Function

    Core histone-binding subunit that may target chromatin assembly factors, chromatin remodeling factors and histone deacetylases to their histone substrates in a manner that is regulated by nucleosomal DNA. Component of several complexes which regulate chromatin metabolism. These include the chromatin assembly factor 1 (CAF-1) complex, which is required for chromatin assembly following DNA replication and DNA repair; the core histone deacetylase (HDAC) complex, which promotes histone deacetylation and consequent transcriptional repression; the nucleosome remodeling and histone deacetylase complex (the NuRD complex), which promotes transcriptional repression by histone deacetylation and nucleosome remodeling; the PRC2/EED-EZH2 complex, which promotes repression of homeotic genes during development; and the NURF (nucleosome remodeling factor) complex.
  • Sequence similarities

    Belongs to the WD repeat RBAP46/RBAP48/MSI1 family.
    Contains 6 WD repeats.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • SDS-PAGE analysis of 5 μg ab196431 on 10% SDS-PAGE gel stained with Coomassie.

References

ab196431 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196431.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up