Overview

  • Product name

    Recombinant Human RbBP5 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MNLELLESFGQNYPEEADGTLDCISMALTCTFNRWGTLLAVGCNDGRIVI WDFLTRGIAKIISAHIHPVCSLCWSRDGHKLVSASTDNIVSQWDVLSGDC DQRFRFPSPILKVQYHPRDQNKVLVCPMKSAPVMLTLSDSKHVVLPVDDD SDLNVVASFDRRGEYIYTGNAKGKILVLKTDSQDLVASFRVTTGTSNTTA IKSIEFARKGSCFLINTADRIIRVYDGREILTCGRDGEPEPMQKLQDLVN RTPWKKCCFSGDGEYIVAGSARQHALYIWEKSIGNLVKILHGTRGELLLD VAWHPVRPIIASISSGVVSIWAQNQVENWSAFAPDFKELDENVEYEERES EFDIEDEDKSEPEQTGADAAEDEEVDVTSVDPIAAFCSSDEELEDSKALL YLPIAPEVEDPEENPYGPPPDAVQTSLMDEGASSEKKRQSSADGSQPPKK KPKTTNIELQGVPNDEVHPLLGVKGDGKSKKKQAGRPKGSKGKEKDSPFK PKLYKGDRGLPLEGSAKGKVQAELSQPLTAGGAISELL
    • Molecular weight

      86 kDa including tags
    • Amino acids

      1 to 538
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab132195 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • RBBP 5
    • RBBP-5
    • RBBP5
    • RBBP5_HUMAN
    • RBQ 3
    • RBQ3
    • Retinoblastoma binding protein 5
    • Retinoblastoma binding protein RBQ3
    • Retinoblastoma binding protein5
    • Retinoblastoma-binding protein 5
    • Retinoblastoma-binding protein RBQ-3
    • SWD1
    • SWD1, Set1c WD40 repeat protein, homolog
    see all
  • Function

    As part of the MLL1/MLL complex it is involved in methylation and dimethylation at 'Lys-4' of histone H3. H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation.
  • Tissue specificity

    Ubiquitously expressed.
  • Sequence similarities

    Contains 6 WD repeats.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132195 stained with Coomassie Blue.

References

ab132195 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132195.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up