Overview

  • Product name
    Recombinant Human RBM11 protein (His tag) (denatured)
    See all RBM11 proteins and peptides
  • Protein length
    Full length protein
  • Description
    Recombinant Human RBM11 protein (His tag)

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMFPAQEEADRTVFVGNLEARVREEILY ELFLQAGPLTKVTICKDREGKPKSFGFVCFKHPESVSYAIALLNGIRLYG RPINVQYRFGSSRSSEPANQSFESCVKINSHNYRNEEMLVGRSSFPMQYF PINNTSLPQEYFLFQKMQWHVYNPVLQLPYYEMTAPLPNSASVSSSLNHV PDLEAGPSSYKWTHQQPSDSDLYQMTAPLPNSASVSSSLNHVPDLEAGPS SYKWTHQQPSDSDLYQMNKRKRQKQTSDSDSSTDNNRGNECSQKFRKSKK KKRY
    • Molecular weight
      35 kDa including tags
    • Amino acids
      1 to 281
    • Tags
      His tag N-Terminus
    • Additional sequence information
      (NP_658983).

Specifications

Our Abpromise guarantee covers the use of ab174404 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 85 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

General Info

  • Alternative names
    • Putative RNA binding protein 11
    • RNA binding motif protein 11
    • Splicing regulator RBM11
  • Relevance
    RBM11, also known as RNA binding motif protein 11, is a human gene. 2 isoforms of the human protein are produced by alternative splicing.

Images

  • 15% SDS-PAGE analysis of ab174404 at 3μg.

References

ab174404 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174404.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up