Overview

  • Product name

    Recombinant Human RBM18 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMEAETKTLPLENASILSEGSLQEGHRL WIGNLDPKITEYHLLKLLQKFGKVKQFDFLFHKSGALEGQPRGYCFVNFE TKQEAEQAIQCLNGKLALSKKLVVRWAHAQVKRYDHNKNDKILPISLEPS SSTEPTQSNLSVTAKIKAIEAKLKMMAENPDAEYPAAPVYSYFKPPDKKR TTPYSRTAWKSRR
    • Molecular weight

      24 kDa including tags
    • Amino acids

      1 to 190
    • Tags

      His tag N-Terminus
    • Additional sequence information

      (NCBI Accession No.: NP_149108)

Specifications

Our Abpromise guarantee covers the use of ab187430 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Purity

    > 85 % SDS-PAGE.
    ab187430 was purified using conventional chromatography techniques
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 90% PBS, 10% Glycerol

General Info

  • Alternative names

    • Probable RNA-binding protein 18
    • rbm18
    • RBM18_HUMAN
    • RNA-binding motif protein 18
  • Sequence similarities

    Contains 1 RRM (RNA recognition motif) domain.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab187430.

References

ab187430 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187430.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up