Overview

  • Product name

    Recombinant Human RBM23 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MASDDFDIVIEAMLEAPYKKEEDEQQRKEVKKDYPSNTTSSTSNSGNETS GSSTIGETSNRSRDRDRYRRRNSRSRSPGRQCRHRSRSWDRRHGSESRSR DHRREDRVHYRSPPLATGYRYGHSKSPHFREKSPVREPVDNLSPEERDAR TVFCMQLAARIRPRDLEDFFSAVGKVRDVRIISDRNSRRSKGIAYVEFCE IQSVPLAIGLTGQRLLGVPIIVQASQAEKNRLAAMANNLQKGNGGPMRLY VGSLHFNITEDMLRGIFEPFGKIDNIVLMKDSDTGRSKGYGFITFSDSEC ARRALEQLNGFELAGRPMRVGHVTERLDGGTDITFPDGDQELDLGSAGGR FQLMAKLAEGAGIQLPSTAAAAAAAAAAQAAALQLNGAVPLGALNPAALT ALSPALNLASQCFQLSSLFTPQTM
    • Amino acids

      1 to 424
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162981 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CAPERbeta
    • FLJ10482
    • MGC4458
    • PP239
    • Probable RNA binding protein 23
    • Probable RNA-binding protein 23
    • RBM 23
    • RBM23
    • RBM23_HUMAN
    • RNA binding motif protein 23
    • RNA binding region (RNP1 RRM) containing 4
    • RNA binding region containing protein 4
    • RNA-binding motif protein 23
    • RNA-binding region-containing protein 4
    • RNPC4
    • Splicing factor SF2
    see all
  • Function

    Probable RNA-binding protein. May be involved in pre-mRNA splicing process.
  • Sequence similarities

    Belongs to the splicing factor SR family.
    Contains 2 RRM (RNA recognition motif) domains.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab162981 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162981 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162981.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up