Overview

  • Product name
    Recombinant Human RBM35A protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTASPDYLVVLFGITAGATGAKLGSDEKELILLFWKVVDLANKKVGQLHE VLVRPDQLELTEDCKEETKIDVESLSSASQLDQALRQFNQSVSNELNIGV GTSFCLCTDGQLHVRQILHPEASKKNVLLPECFYSFFDLRKEFKKCCPGS PDIDKLDVATMTEYLNFEKSSSVSRYGASQVEDMGNIILAMISEPYNHRF SDPERVNYKFESGTCSKMELIDDNTVVRARGLPWQSSDQDIARFFKGLNI AKGGAALCLNAQGRRNGEALVRFVSEEHRDLALQRHKHHMGTRYIEVYKA TGEDFLKIAGGTSNEVAQFLSKENQVIVRMRGLPFTATAEEVVAFFGQHC PITGGKEGILFVTYPDGRPTGDAFVLFACEEYAQNALRKHKDLLGKRYIE LFRSTAAEVQQVLNRFSSAPLIPLPTPPIIPVLPQQFVPPTNVRDCIRLR GLPYAATIEDILDFLGEFATDIRTHGVHMVLNHQGRPSGDAFIQMKSADR AFMAAQKCHKKNMKDRYVEVFQCSAEEMNFVLMGGTLNRNGLSPPPCKLP CLSPPSYTFPAPAAVIPTEAAIYQPSVILNPRALQPSTAYYPAGTQLFMN YTAYYPSPPGSPNSLGYFPTAANLSGVPPQPGTVVRMQGLAYNTGVKEIL NFFQGYQYATEDGLIHTNDQARTLPKEWVCI
    • Amino acids
      1 to 681
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162859 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Epithelial splicing regulatory protein 1
    • Esrp1
    • ESRP1_HUMAN
    • FLJ20171
    • RBM35A
    • RMB35A
    • RNA binding motif protein 35A
    • RNA-binding motif protein 35A
    • RNA-binding protein 35A
    see all
  • Function
    mRNA splicing factor that regulates the formation of epithelial cell-specific isoforms. Specifically regulates the expression of FGFR2-IIIb, an epithelial cell-specific isoform of FGFR2. Also regulates the splicing of CD44, CTNND1, ENAH, 3 transcripts that undergo changes in splicing during the epithelial-to-mesenchymal transition (EMT). Acts by directly binding specific sequences in mRNAs. Binds the GU-rich sequence motifs in the ISE/ISS-3, a cis-element regulatory region present in the mRNA of FGFR2.
  • Tissue specificity
    Epithelial cell-specific.
  • Sequence similarities
    Belongs to the ESRP family.
    Contains 3 RRM (RNA recognition motif) domains.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab162859 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162859 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162859.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up