Description

  • Product name

    Recombinant Human RBMY1A1 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      YGTSHGAPPARGPRMSYGGSTCHAYSNTRDRYGRSWESYSSCGDFHYCDR EHVCRKDQRNPPSLGRVLPDPREACGSSSYVASIVDGGESRSEKGDSSRY
    • Amino acids

      257 to 356
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159322 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • family 1 member A1
    • hRBMY
    • MGC181956
    • RBM
    • RBM1
    • RBM2
    • RBMY
    • Rbmy1a1
    • RBMY1C
    • RBY1A_HUMAN
    • RNA binding motif protein 1
    • RNA binding motif protein 2
    • RNA binding motif protein Y chromosome family 1 member
    • RNA binding motif protein Y chromosome family 1 member A1
    • RNA binding motif protein Y chromosome family 1 member A1/C
    • RNA binding motif protein Y linked family 1 member A1
    • RNA-binding motif protein
    • RNA-binding motif protein 1
    • RNA-binding motif protein 2
    • Y chromosome
    • Y chromosome RNA recognition motif 1
    • YRRM1
    • YRRM2
    see all
  • Function

    RNA-binding protein involved in pre-mRNA splicing. Required for sperm development. Acts additively with TRA2B to promote exon 7 inclusion of the survival motor neuron SMN. Binds non-specifically to mRNAs.
  • Tissue specificity

    Testis-specific.
  • Sequence similarities

    Contains 1 RRM (RNA recognition motif) domain.
  • Developmental stage

    Expressed in all of the transcriptionally active stages of germ cell development from spermatogonia through spermatocytes to round spermatids.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab159322 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159322 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159322.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up