Description

  • Product name

    Recombinant Human RBP3/IRBP protein (His tag)
    See all RBP3/IRBP proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MNHKVHHHHHHMTLRSALPGVVHCLQEVLKDYYTLVDRVPTLLQHLASMD FSTVVSEEDLVTKLN AGLQAASEDPRLLVRAIGPTETPSWPAPDAAAEDSPGVAPELPEDEAIRQ ALVDSVFQVSVLPGN VGYLRFDSFADASVLGVLAPYVLRQVWEPLQDTEHLIMDLRHNPGGPSSA VPLLLSYFQGPEAGP VHLFTTYDRRTNITQEHFSHMELPGPRYSTQRGVYLLTSHRTATAAEEFA FLMQSLGWATLVGEI TAGNLLHTRTVPLLDTPEGSLALTVPVLTFIDNHGEAWLGGGVVPDAIVL AEEALDKAQEVL
    • Predicted molecular weight

      35 kDa including tags
    • Amino acids

      321 to 630
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab215617 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

    Previously labelled as RBP3. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.

  • Reconstitution
    Reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days.

General Info

  • Alternative names

    • D10S64
    • D10S65
    • D10S66
    • Interphotoreceptor retinoid binding protein
    • Interphotoreceptor retinoid-binding protein
    • Interstitial retinol binding protein
    • Interstitial retinol-binding protein
    • IRBP
    • RBP 3
    • rbp3
    • RBPI
    • RET3_HUMAN
    • Retinol binding protein 3
    • Retinol binding protein 3 interstitial
    • Retinol-binding protein 3
    • RP66
    see all
  • Function

    IRBP shuttles 11-cis and all trans retinoids between the retinol isomerase in the pigment epithelium and the visual pigments in the photoreceptor cells of the retina.
  • Sequence similarities

    Belongs to the peptidase S41A family.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix > interphotoreceptor matrix. Interphotoreceptor matrix that permeates the space between the retina and the contiguous layer of pigment epithelium cells.
  • Information by UniProt

Images

  • Lane 1 - Non-Reducing

    Lane 2 - Reducing

References

ab215617 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab215617.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up