Description

  • Product name

    Recombinant Human RBP5 protein
  • Purity

    > 95 % SDS-PAGE.
    ab99438 is purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMPPNLTGYYRFVSQKNMEDYLQALNISLAV RKIALLLKPDKEIEHQGNHMTVRTLSTFRNYTVQFDVGVEFEEDLRSVDG RKCQTIVTWEEEHLVCVQKGEVPNRGWRHWLEGEMLYLELTARDAVCEQV FRKVR
    • Predicted molecular weight

      18 kDa including tags
    • Amino acids

      1 to 135
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99438 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.0308% DTT, 0.316% Tris HCl, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names

    • Cellular retinol-binding protein III
    • CRBP III
    • CRBP-III
    • CRBP3
    • CRBPIII
    • HRBPiso
    • OTTHUMP00000238163
    • Putative cellular retinol binding protein CRBP III
    • RBP5
    • RET5_HUMAN
    • Retinol binding protein
    • Retinol binding protein 5
    • Retinol binding protein 5, cellular
    • Retinol-binding protein 5
    see all
  • Function

    Intracellular transport of retinol.
  • Tissue specificity

    Higher expression in adult kidney and liver and to a lesser extent in adult and fetal spleen, adult lymph nodes and appendix, and fetal liver and kidney. Strongly decreased in hepatocellular carcinoma tissues (at protein level).
  • Sequence similarities

    Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.
  • Domain

    Forms a beta-barrel structure that accommodates hydrophobic ligands in its interior.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab99438 at approximately 18.1kDa (3µg).

References

ab99438 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab99438.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up