Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      VDVGKWPIFTLLSPQEIASIRKACVFGTSASEALYVTDNDEVFVFGLNYS NCLGTGDNQSTLVPKKLEGLCGKKIKSLSYGSGPHVLLS
    • Amino acids

      2 to 90
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163018 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as CLLD7

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Chronic lymphocytic leukemia deletion region gene 7 protein
    • CLL deletion region gene 7 protein
    • CLLL7
    • CLLL7 protein
    • E4.5
    • GDP/GTP exchange factor (GEF) like protein
    • GLP
    • Guanine nucleotide exchange factor
    • Hypothetical protein FLJ39335
    • RCBT1_HUMAN
    • Rcbtb1
    • RCC1 and BTB domain-containing protein 1
    • Regulator of chromosome condensation (RCC1) and BTB (POZ) domain containing protein 1
    • Regulator of chromosome condensation and BTB domain-containing protein 1
    • RP11-185C18.1
    see all
  • Function

    May be involved in cell cycle regulation by chromatin remodeling.
  • Tissue specificity

    Ubiquitously expressed.
  • Sequence similarities

    Contains 2 BTB (POZ) domains.
    Contains 6 RCC1 repeats.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab163018 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163018 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163018.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up