Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      TIEPRRLDSLNGKKIACLSYGSGPHIVLATTEGEVFTWGHNAYSQLGNGT TNHGLVPCHISTNLSNKQVIEVACGSYHSLVLTSDGEVFAWGYNNSGQVG SGSTVNQPI
    • Amino acids

      86 to 194
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158105 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as RCBTB2

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CHC1 L
    • CHC1L
    • Chromosome condensation 1 like
    • RCBT2
    • RCBT2_HUMAN
    • Rcbtb2
    • RCC1 and BTB domain containing protein 2
    • RCC1 and BTB domain-containing protein 2
    • RCC1 like G exchanging factor
    • RCC1 like G exchanging factor RLG
    • Regulator of chromosome condensation (RCC1) and BTB (POZ) domain containing protein 2
    • Regulator of chromosome condensation (RCC1) and BTB domain containing protein 2
    • Regulator of chromosome condensation and BTB domain containing protein 2
    • RLG
    see all
  • Information by UniProt

Images

  • ab158105 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158105 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158105.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up