Description

  • Product name

    Recombinant Human RCL protein
  • Purity

    > 95 % SDS-PAGE.
    ab100943 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMAAAMVPGRSESWERGEPGRPALYFCGSIR GGREDRTLYERIVSRLRRFGTVLTEHVAAAELGARGEEAAGGDRLIHEQD LEWLQQADVVVAEVTQPSLGVGYELGRAVAFNKRILCLFRPQSGRVLSAM IRGAADGSRFQVWDYEEGEVEALLDRYFEADPPGQVAASPDPTT
    • Predicted molecular weight

      21 kDa including tags
    • Amino acids

      1 to 174
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab100943 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.0154% DTT, 0.316% Tris HCl, 10% Glycerol

General Info

  • Alternative names

    • 2' deoxynucleoside 5' phosphate N hydrolase 1
    • BC048355
    • c Myc responsive
    • c Myc responsive protein Rcl
    • c-Myc-responsive protein Rcl
    • C6orf108
    • C76683
    • Chromosome 6 open reading frame 108
    • Deoxyribonucleoside 5' monophosphate N glycosidase
    • Deoxyribonucleoside 5''-monophosphate N-glycosidase
    • dJ330M21.3
    • DNPH1
    • MGC54855
    • Putative c Myc responsive
    • Rcl
    • RCL_HUMAN
    • RP3 330M21.3
    see all
  • Function

    Catalyzes the cleavage of the N-glycosidic bond of deoxyribonucleoside 5'-monophosphates to yield deoxyribose 5-phosphate and a purine or pyrimidine base. Deoxyribonucleoside 5'-monophosphates containing purine bases are preferred to those containing pyrimidine bases.
  • Tissue specificity

    Expressed at low levels in brain, colon, lung, peripheral blood leukocytes, placenta, small intestine, and thymus. Expressed at high levels in heart, kidney, liver, skeletal muscle and spleen. Overexpressed in a significant proportion of breast cancers.
  • Sequence similarities

    Belongs to the deoxyribonucleoside 5'-monophosphate N-glycosidase family.
  • Cellular localization

    Nucleus. Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab100943 at approximately 21.2kDa (3µg).

References

ab100943 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab100943.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up