Recombinant Human RCSD 1 protein (ab164897)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEKATEVKGERVQNEEVGPEHDSQETKKLEEGAAVKETPHSPPGGVKGGD VPKQEKGKEKQQEGAVLEPGCSPQTGPAQLETSSEVQSEPAVPKPEDDTP VQDTKM
    • Amino acids
      1 to 106
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164897 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • A430105K13Rik
    • BC025872
    • CapZ interacting protein
    • Capz-interacting protein
    • CAPZIP
    • CPZIP_HUMAN
    • MGC126585
    • MGC126611
    • MGC128398
    • MGC21854
    • MGC32399
    • MK2S4
    • Protein kinase substrate CapZIP
    • Protein kinase substrate MK2S4
    • RCSD domain containing 1
    • RCSD domain-containing protein 1
    • Rcsd1
    • RGD1304715
    • RP3-503M14.1
    see all
  • Function
    Stress-induced phosphorylation of CAPZIP may regulate the ability of F-actin-capping protein to remodel actin filament assembly.
  • Tissue specificity
    Highly expressed in skeletal muscle and more weakly in cardiac muscle. Also expressed in several lymphoid organs, including spleen, thymus, peripheral blood leukocytes, lymph node and bone marrow.
  • Sequence similarities
    Contains 1 RCSD domain.
  • Post-translational
    modifications
    Dephosphorylation results in its dissociation from CAPZA2.
  • Information by UniProt

Images

  • ab164897 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164897 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164897.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up