Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MNIVVEFFVVTFKVLWAFVLAAARWLVRPKEKSVAGQVCLITGAGSGLGR LFALEFARRRALLVLWDINTQSNEETAGMVRHIYRDLEAADAAALQAGNG EEEILPHCNLQVFTYTCDVGKRENVYLTAERVRKEVGEVSVLVNNAGVVS GHHLLECPDELIERTMMVNCHAHFWTTKAFLPTMLEINHGHIVTVASSLG LFSTAGVEDYCASKFGVVGFHESLSHELKAAEKDGIKTTLVCPYLVDTGM FRGCRIRKEIEPFLPPLKPDYCVKQAMKAILTDQPMICTPRLMYIVTFMK SILPFEAVVCMYRFLGADKCMYPFIAQRKQATNNNEAKNGI
    • Molecular weight

      65 kDa including tags
    • Amino acids

      1 to 341

Specifications

Our Abpromise guarantee covers the use of ab132877 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • RDH 10
    • RDH10
    • RDH10_HUMAN
    • Retinol dehydrogenase 10
    • Retinol dehydrogenase 10 (all trans)
    • SDR16C4
    • Short chain dehydrogenase/reductase family 16C member 4
    see all
  • Function

    Retinol dehydrogenase with a clear preference for NADP. Converts all-trans-retinol to all-trans-retinal. Has no detectable activity towards 11-cis-retinol, 9-cis-retinol and 13-cis-retinol.
  • Tissue specificity

    Detected in retina, kidney, liver, small intestine, placenta, lung, heart and skeletal muscle.
  • Pathway

    Cofactor metabolism; retinol metabolism.
  • Sequence similarities

    Belongs to the short-chain dehydrogenases/reductases (SDR) family.
  • Cellular localization

    Microsome membrane. Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132877 stained with Coomassie Blue.

References

ab132877 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132877.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up