Overview

  • Product name
    Recombinant Human RDH11 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      IRKMLSSGVCTSTVQLPGKVVVVTGANTGIGKETAKELAQRGARVYLACR DVEKGELVAKEIQTTTGNQQVLVRKLDLSDTKSIRAFAKGFLAEEKHLHV LINNAGVMMCPYSKTADGFEMHIGVNHLGHFLLTHLLLEKLKESAPSRIV NVSSLAHHLGRIHFHNLQGEKFYNAGLAYCHSKLANILFTQELARRLKGS GVTTYSVHPGTVQSELVRHSSFMRWMWWLFSFFIKTPQQGAQTSLHCALT EGLEILSGNHFSDCHVAWVSAQARNETIARRLWDVSCDLLGLPID
    • Amino acids
      24 to 318
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162417 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Androgen regulated short chain dehydrogenase/reductase 1
    • Androgen-regulated short-chain dehydrogenase/reductase 1
    • ARSDR1
    • AU045252
    • C85936
    • CGI 82
    • FLJ32633
    • HCBP12
    • HCV core binding protein
    • HCV core binding protein HCBP12
    • HCV core-binding protein HCBP12
    • MDT1
    • Prostate short chain dehydrogenase/reductase 1
    • Prostate short-chain dehydrogenase/reductase 1
    • PSDR1
    • RALR1
    • RDH11
    • RDH11_HUMAN
    • Retinal reductase 1
    • Retinol dehydrogenase 11
    • retinol dehydrogenase 11 (all trans/9 cis/11 cis)
    • SCALD
    • SDR7C1
    • Short chain dehydrogenase/reductase family 7C, member 1
    see all
  • Function
    Exhibits an oxidoreductive catalytic activity towards retinoids. Most efficient as an NADPH-dependent retinal reductase. Displays high activity towards 9-cis and all-trans-retinol. Also involved in the metabolism of short-chain aldehydes. No steroid dehydrogenase activity detected.
  • Tissue specificity
    Predominantly expressed in the epithelial cells of prostate, in both basal and luminal secretory cell populations. Expressed at low levels in spleen, thymus, testis, ovary, small intestine, colon, peripherical blood leukocytes, kidney, adrenal gland and fetal liver. Not detected in prostatic fibromuscular stromal cells, endothelial cells, or infiltrating lymphocytes.
  • Sequence similarities
    Belongs to the short-chain dehydrogenases/reductases (SDR) family.
  • Post-translational
    modifications
    Not glycosylated.
  • Cellular localization
    Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • ab162417 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162417 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162417.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up