Overview

  • Product name

    Recombinant Human RDH5 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      GLEAFSDSLRRDVAHFGIRVSIVEPGFFRTPVTNLESLEKTLQACWARLP PATQAHYGGAFLTKYLKMQQRIMNLICDPDLTKVSRCLEHALTARHPRTR
    • Amino acids

      181 to 280
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159323 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 11 cis RDH
    • 11 cis retinol dehydrogenase
    • 9 cis retinol specific dehydrogenase
    • FLJ39337
    • FLJ97089
    • HSD17B9
    • RDH 5
    • RDH1
    • Retinol dehydrogenase 1
    • Retinol dehydrogenase 5
    • Retinol dehydrogenase 5 (11 cis/9 cis)
    • SDR9C5
    • Short chain dehydrogenase/reductase family 9C member 5
    see all
  • Relevance

    RDH5 encodes an enzyme belonging to the short-chain dehydrogenases/reductases (SDR) family. This retinol dehydrogenase functions to catalyze the final step in the biosynthesis of 11-cis retinaldehyde, which is the universal chromophore of visual pigments. Mutations in this gene cause autosomal recessive fundus albipunctatus, a rare form of night blindness that is characterized by a delay in the regeneration of cone and rod photopigments.
  • Cellular localization

    Membrane; Peripheral membrane protein

Images

  • ab159323 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159323 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159323.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up