Overview

  • Product name
    Recombinant Human REA protein (denatured)
    See all REA proteins and peptides
  • Protein length
    Full length protein
  • Description
    Recombinant Human REA protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMAQNLKDLAGRLPAGPRGMGTALKLLL GAGAVAYGVRESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRIPWFQY PIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLD YEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSL ILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQ AEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADN LVLNLQDESFTRGSDSLIKGKK
    • Molecular weight
      36 kDa including tags
    • Amino acids
      1 to 299
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab167836 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 85 % SDS-PAGE.

  • Form
    Liquid
  • Additional notes

    PHB2 acts as a mediator of transcriptional repression by nuclear hormone receptors via recruitment of histone deacetylases by similarity. This protein functions as an estrogen receptor (ER)-selective coregulator that potentiates the inhibitory activities of antiestrogens and represses the activity of estrogens. PHB2 competes with NCOA1 for modulation of ER transcriptional activity. It is probably involved in regulating mitochondrial respiration activity and in aging. Recombinant human PHB2 protein, fused to His-tag at N-terminus, was expressed in E.coli.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 2.4% Urea, 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names
    • B cell receptor associated protein BAP37
    • B-cell receptor-associated protein BAP37
    • BAP
    • Bap37
    • BCAP 37
    • D prohibitin
    • D-prohibitin
    • p22
    • Phb2
    • PHB2_HUMAN
    • PNAS 141
    • Prohibitin 2
    • Prohibitin-2
    • Repressor of estrogen receptor activity
    see all
  • Function
    Acts as a mediator of transcriptional repression by nuclear hormone receptors via recruitment of histone deacetylases (By similarity). Functions as an estrogen receptor (ER)-selective coregulator that potentiates the inhibitory activities of antiestrogens and represses the activity of estrogens. Competes with NCOA1 for modulation of ER transcriptional activity. Probably involved in regulating mitochondrial respiration activity and in aging.
  • Sequence similarities
    Belongs to the prohibitin family.
  • Developmental stage
    Levels of expression in fibroblasts decrease heterogeneously during cellular aging.
  • Cellular localization
    Mitochondrion inner membrane. Cytoplasm. Nucleus. Also cytoplasmic and nuclear.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab167836 (3 µg).

References

ab167836 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167836.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up