Description

  • Product name

    Recombinant Human REC8 protein
    See all REC8 proteins and peptides
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MFYYPNVLQRHTGCFATIWLAATRGSRLVKREYLRVNVVKTCEEILNYVL VRVQPPQPGLPRPRFSLYLSAQLQIGVIRVYSQQCQYLVEDIQHILERLH RAQLQIRIDMETELPSLLLPNHLAMMETLEDAPDPFFGMMSVDPRLPSPF DIPQIRHLLEAAIPERVEEIPPEVPTEPREPERIPVTVLPPEAITILEAE PIRMLEIEGERELPEVSRRELDLLIAEEEEAILLEIPRLPPPAPAEVEGI GEALGPEELRLTGWEPGALLMEVTPPEELRLPAPPSPERRPPVPPPPRRR RRRRLLFWDKETQISPEKFQEQLQTRAHCWECPMVQPPERTIRGPAELFR TPTLSGWLPPELLGLWTHCAQPPPKALRRELPEEAAAEEERRKIEVPSEI EVPREALEPSFPLMVSLEISLEAAEEEKSRISLIPPEERWAWPEVEAPEA PALPVVPELPEVPMEMPLVLPPELELLSLEAVHRAVALELQANREPDFSS LVSPLSPRRMAARVFYLLLVLSAQQILHVKQEKPYGRLLIQPGPRFH
    • Predicted molecular weight

      89 kDa including tags
    • Amino acids

      1 to 547

Specifications

Our Abpromise guarantee covers the use of ab132427 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Cohesin Rec8p
    • Human homolog of rad21 S. pombe
    • Meiotic recombination and sister chromatid cohesion phosphoprotein of the rad21p family
    • Meiotic recombination protein REC8 homolog
    • Meiotic recombination protein REC8-like 1
    • rec8
    • REC8 homolog (yeast)
    • REC8 like 1
    • REC8_HUMAN
    • Rec8p
    • Recombination and sister chromatid cohesion protein homolog
    see all
  • Function

    Required during meiosis for separation of sister chromatids and homologous chromosomes. Proteolytic cleavage of REC8 on chromosome arms by separin during anaphase I allows for homologous chromosome separation in meiosis I and cleavage of REC8 on centromeres during anaphase II allows for sister chromatid separation in meiosis II.
  • Tissue specificity

    Expressed in testis and thymus.
  • Sequence similarities

    Belongs to the rad21 family.
  • Post-translational
    modifications

    Phosphorylated.
  • Cellular localization

    Nucleus. Chromosome. In meiotic chromosomes, localized along axial elements in prophase from the leptotene to diplotene stages. At later prophase stages, diakinesis and metaphase I, localized along interstitial axes of chromosomes including both centromere and arm regions. No longer detected in arm regions in anaphase I but persists on centromere regions until metaphase II.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132427 stained with Coomassie Blue.

References

ab132427 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132427.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up