Overview

  • Product name

    Recombinant Human RECQL5 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MSSHHTTFPFDPERRVRSTLKKVFGFDSFKTPLQESATMAVVKGNKDVFV CMPTGAGKSLCYQLPALLAKGITIVVSPLIALIQDQVDHLLTLKVRVSSL NSKLSAQERKELLADLEREKPQTKILYITPEMAASSSFQPTLNSLVSRHL LSYLVVDEAHCVSQWGHDFRPDYLRLGALRSRLGHAPCVALTATATPQVQ EDVFAALHLKKPVAIFKTPCFRANLFYDVQFKELISDPYGNLKDFCLKAL GQEADKGLSGCGIVYCRTREACEQLAIELSCRGVNAKAYHAGLKASERTL VQNDWMEEKVPVIVATISFGMGVDKANVRFVAHWNIAKSMAGYYQESGRA GRDGKPSWCRLYYSRNDRDQVSFLIRKEVAKLQEKRGNKASDKATIMAFD ALVTFCEELGRWGRGHGKSLRAAWCSQVVSRHAEL
    • Molecular weight

      74 kDa including tags
    • Amino acids

      1 to 435

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132275 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ATP-dependent DNA helicase Q5
    • DNA helicase
    • DNA helicase, RecQ like type 5
    • DNA helicase, RECQ-like, type 5
    • EC 3.6.1.-
    • FLJ90603
    • RecQ helicase protein-like 5 beta
    • RecQ protein-like 5
    • RecQ protein-like 5, isoform CRA_b
    • RecQ-like type 5
    • RecQ5
    • RECQ5_HUMAN
    • Recq5b
    • RECQL5
    • Recql5b
    see all
  • Function

    May have an important role in DNA metabolism.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the helicase family. RecQ subfamily.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
  • Cellular localization

    Cytoplasm and Nucleus > nucleoplasm.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132275 stained with Coomassie Blue.

References

ab132275 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132275.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up