Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDIEDEENMSSSSTDVKENRNLDNVSPKDGSTPGPGEGSQLSNGGGGGPG RKRPLEEGSNGHSKYRLKKRRKTPGPVLPKNALMQLNEIKPGLQYTLLSQ TGPVHAPLFVMSVEVNGQVFEGSGPTKKKAKLHAAEKALRSFVQFPNASE AHLAMGRTLSVNTDFTSDQADFPDTLFNGFETPDKAEPPFYVGSNGDDSF SSSGDLSLSASPVPASLAQPPLPVLPPFPPPSGKNPVMILNELRPGLKYD FLSESGESHAKSFVMSVVVDGQFFEGSGRNKKLAKARAAQSALAAIFNLH LDQTPSRQPIPSEGLQLHLPQVLADAVSRLVLGKFGDLTDNFSSPHARRK VLAGVVMTTGTDVKDAKVISVSTGTKCINGEYMSDRGLALNDCHAEIISR RSLLRFLYTQLELYLNNKDDQKRSIFQKSERGGFRLKENVQFHLYISTSP CGDARIFSPHEPILEGSRSYTQAGVQWCNHGSLQPRPPGLLSDPSTSTFQ GAGTTEPADRHPNRKARGQLRTKIESGEGTIPVRSNASIQTWDGVLQGER LLTMSCSDKIARWNVVGIQGSLLSIFVEPIYFSSIILGSLYHGDHLSRAM YQRISNIEDLPPLYTLNKPLLSGISNAEARQPGKAPNFSVNWTVGDSAIE VINATTGKDELGRASRLCKHALYCRWMRVHGKVPSHLLRSKITKPNVYHE SKLAAKEYQAAKARLFTAFIKAGLGAWVEKPTEQDQFSLTP
    • Amino acids
      1 to 741
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157847 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ADARB 1
    • ADARB1
    • 1700057H01Rik
    • ADAR2
    • ADAR2a
    • ADAR2a L1
    • ADAR2a L2
    • ADAR2a L3
    • ADAR2b
    • ADAR2c
    • ADAR2d
    • ADAR2g
    • Adarb1
    • Adenosine deaminase, RNA specific, 2
    • Adenosine deaminase, RNA specific, B1
    • Adenosine deaminase, RNA specific, B1 (homolog of rat RED1)
    • Adenosine deaminase, RNA specific, B1 (RED1 homolog rat)
    • AW124433
    • AW558573
    • BB220382
    • D10Bwg0447e
    • Double stranded RNA specific editase 1
    • Double-stranded RNA-specific editase 1
    • DRABA2
    • DRADA2
    • dsRNA adenosine deaminase
    • EC 3.5.-.-
    • Human dsRNA adenosine deaminase DRADA2
    • Human dsRNA adenosine deaminase DRADA2b, EC 3.5
    • OTTHUMP00000115341
    • OTTHUMP00000115342
    • RED 1
    • RED1_HUMAN
    • RNA editase
    • RNA editase 1
    • RNA editing deaminase 1
    • RNA editing enzyme 1
    • RNA editing enzyme 1, rat, homolog of
    • RNA specific adenosine deaminase B1
    • RNA-editing deaminase 1
    • RNA-editing enzyme 1
    see all
  • Function
    Catalyzes the hydrolytic deamination of adenosine to inosine in double-stranded RNA (dsRNA) referred to as A-to-I RNA editing. This may affect gene expression and function in a number of ways that include mRNA translation by changing codons and hence the amino acid sequence of proteins; pre-mRNA splicing by altering splice site recognition sequences; RNA stability by changing sequences involved in nuclease recognition; genetic stability in the case of RNA virus genomes by changing sequences during viral RNA replication; and RNA structure-dependent activities such as microRNA production or targeting or protein-RNA interactions. Can edit both viral and cellular RNAs and can edit RNAs at multiple sites (hyper-editing) or at specific sites (site-specific editing). Its cellular RNA substrates include: bladder cancer-associated protein (BLCAP), neurotransmitter receptors for glutamate (GRIA2 and GRIK2) and serotonin (HTR2C), GABA receptor (GABRA3) and potassium voltage-gated channel (KCNA1). Site-specific RNA editing of transcripts encoding these proteins results in amino acid substitutions which consequently alter their functional activities. Edits GRIA2 at both the Q/R and R/G sites efficiently but converts the adenosine in hotspot1 much less efficiently. Can exert a proviral effect towards human immunodeficiency virus type 1 (HIV-1) and enhances its replication via both an editing-dependent and editing-independent mechanism. The former involves editing of adenosines in the 5'UTR while the latter occurs via suppression of EIF2AK2/PKR activation and function. Can inhibit cell proliferation and migration and can stimulate exocytosis.
  • Tissue specificity
    Highly expressed in brain and heart and at lower levels in placenta. Fair expression in lung, liver and kidney. Detected in brain, heart, kidney, lung and liver (at protein level). Isoform 5 is high expressed in hippocampus and colon. Isoform 5 is expressed in pediatric astrocytomas and the protein has a decreased RNA-editing activity. The decrease in RNA editing correlates with the grade of malignancy of the tumors, with the high grade tumors showing lower editing is seen.
  • Sequence similarities
    Contains 1 A to I editase domain.
    Contains 2 DRBM (double-stranded RNA-binding) domains.
  • Cellular localization
    Nucleus. Nucleus > nucleolus. Shuttles between nucleoli and the nucleoplasm.
  • Information by UniProt

Images

  • ab157847 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab157847 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157847.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up