Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      QEAQTELPQARISCPEGTNAYRSYCYYFNEDRETWVDADLYCQNMNSGNL VSVLTQAEGA FVASLIKESGTDDFNVWIGLHDPKKNRRWHWSSGSLVSYKSWGIGAPSSV NPGYCVSLTS STGFQKWKDVPCEDKFSFVCKFKNVDHHHHHH
    • Molecular weight

      17 kDa including tags
    • Amino acids

      23 to 166
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152035 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level

    < 0.100 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    ab152035 was determined to be >95% pure by SEC-HPLC and reducing SDS-PAGE.
  • Form

    Lyophilised
  • Additional notes

    Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Please see notes section.

    pH: 7.20
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

General Info

  • Alternative names

    • ICRF
    • Islet cells regeneration factor
    • Islet of Langerhans regenerating protein
    • Lithostathine
    • Lithostathine 1 alpha
    • Lithostathine 1 alpha precursor
    • Lithostathine-1-alpha
    • MGC12447
    • P19
    • Pancreatic stone protein
    • Pancreatic stone protein secretory
    • Pancreatic thread protein
    • Protein X
    • PSP
    • PSPS
    • PSPS1
    • PTP
    • RATRGPI
    • REG
    • REG-1-alpha
    • Reg1
    • REG1A
    • REG1A_HUMAN
    • Regenerating islet derived 1 alpha
    • Regenerating islet derived 1 alpha pancreatic stone protein pancreatic thread protein
    • Regenerating islet-derived protein 1-alpha
    • Regenerating protein I alpha
    see all
  • Function

    Might act as an inhibitor of spontaneous calcium carbonate precipitation. May be associated with neuronal sprouting in brain, and with brain and pancreas regeneration.
  • Tissue specificity

    In pancreatic acinar cells and, in lower levels, in brain. Enhanced expression of PSP-related transcripts and intraneuronal accumulation of PSP-like proteins is found in brain from Alzheimer disease and Down syndrome patients.
  • Sequence similarities

    Contains 1 C-type lectin domain.
  • Developmental stage

    High expression levels in fetal and infant brains; much lower in adult brains.
  • Post-translational
    modifications

    The composition of the O-linked carbohydrate on Thr-27 is complex and varied. In the crystallographic structure, the attached sugar appears to be N-acetylglucosamine, typical of an intracellular protein, rather than N-acetylgalactosamine.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab152035 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152035.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up