Description

  • Product name

    Recombinant Human REG3G protein
  • Purity

    > 95 % SDS-PAGE.
    Determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      EETQKELPSPRISCPKGSKAYGSPCYALFLSPKSWMDADLACQKRPSGKL VSVLSGAEGSFVSSLVRSISNSYSYIWIGLHDPTQGSEPDGDGWEWSSTD VMNYFAWEKNPSTILNPGHCGSLSRSTGFL KWKDYNCDAKLPYVCKFKDVDHHHHHH
    • Predicted molecular weight

      18 kDa including tags
    • Amino acids

      27 to 175
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is for the mature full length protein from aa 27 to 175. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab192295 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Additional notes

    Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
    Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
    Aliquots of reconstituted samples are stable at < -20°C for 3 months.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 99% Phosphate Buffer, 0.87% Sodium chloride

    Lyophilized from a 0.2 µM filtered solution

General Info

  • Alternative names

    • LPPM429
    • Pancreatitis-associated protein 1B
    • Pancreatitis-associated protein IB
    • PAP IB
    • PAP-1B
    • PAP1B
    • PAPIB
    • REG III
    • Reg III-gamma
    • REG-3-gamma
    • REG3G
    • REG3G_HUMAN
    • Regenerating islet derived 3 gamma
    • Regenerating islet-derived protein 3-gamma
    • Regenerating islet-derived protein III-gamma
    • UNQ429
    see all
  • Function

    Might be a stress protein involved in the control of bacterial proliferation.
  • Tissue specificity

    Expressed almost exclusively in the pancreas. Also expressed in testis. Not found in small intestine.
  • Sequence similarities

    Contains 1 C-type lectin domain.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab192295 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab192295.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up