Description

  • Product name

    Recombinant Human REG4 protein
    See all REG4 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Mammalian
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      DIIMRPSCAPGWFYHKSNCYGYFRKLRNWSDAELECQSYGNGAHLASILS LKEASTIAEYISGYQRSQPIWIGLHDPQKRQQWQWIDGAMYLYRSWSGKS MGGNKHCAEMSSNNNFLTWSSNECNKRQHFLCKYRPVDHHHHHH
    • Predicted molecular weight

      17 kDa including tags
    • Amino acids

      23 to 158
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Mature protein.

Specifications

Our Abpromise guarantee covers the use of ab185396 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. Reconstitute for long term storage.

    pH: 7.2
    Constituents: 0.88% Sodium chloride, 99% Phosphate Buffer

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 3X PBS. Please aliquot the reconstituted solution

General Info

  • Alternative names

    • Gastrointestinal secretory protein
    • GISP
    • Reg IV
    • REG like protein
    • REG-4
    • REG-like protein
    • Reg4
    • REG4_HUMAN
    • Regenerating gene type IV
    • Regenerating islet derived family member 4
    • Regenerating islet derived protein 4 precursor
    • Regenerating islet-derived protein 4
    • Regenerating islet-derived protein IV
    • REGIV
    • RELP
    see all
  • Function

    May be involved in inflammatory and metaplastic responses of the gastrointestinal epithelium.
  • Tissue specificity

    Highly expressed in the gastrointestinal tract including the duodenum, jejunum, ileum, ileocecum, appendix, descending colon, pancreas and small intestine. Weakly expressed in normal colon and stomach. Strongly expressed in most colorectal tumors than in normal colon. Preferentially expressed in mucinous tumors and in some cases neuro-endocrine tumors. Expressed in mucus-secreting cells and enterocyte-like cells. In small intestine expressed at the basal perinuclear zone of goblet cells.
  • Sequence similarities

    Contains 1 C-type lectin domain.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab185396 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185396.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up