Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHMGSSHHHHHHSSGLVPRGSHMGSDSWMEEVIKLCGRELVR AQIAICGMSTWSKRSLSQEDAPQTPRPVAEIVPSFINKDTETINMMSEFV ANLPQELKLTLSEMQPALPQLQQHVPVLKDSSLLFEEFKKLIRNRQSEAA DSSPSELKYLGLDTHSRKKRQLYSALANKCCHVGCTKRSLARFC
    • Molecular weight

      21 kDa including tags
    • Amino acids

      25 to 185
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab139240 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 85 % SDS-PAGE.

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as Relaxin 2

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 2.4% Urea, 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names

    • H2
    • REL2_HUMAN
    • Relaxin 2
    • Relaxin A chain
    • Relaxin H2
    • RLN2
    • RLXH2
    see all
  • Function

    Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals. May be involved in remodeling of connective tissues during pregnancy, promoting growth of pubic ligaments and ripening of the cervix.
  • Tissue specificity

    Isoform 1 is expressed in the ovary during pregnancy. Also expressed in placenta, decidua and prostate. Isoform 2 is relatively abundant in placenta. It is in much lower abundance in the prostate gland. Not detected in the ovary.
  • Sequence similarities

    Belongs to the insulin family.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab139240.

References

ab139240 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab139240.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up