Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MQMADAATIATMNKAAGGDKLAELFSLVPDLLEAANTSGNASLQLPDLWW ELGLELPDGAPPGHPPGSGGAESADTEARV
    • Amino acids
      1 to 80
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162494 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • G protein coupled receptor GPCR135
    • G protein coupled receptor SALPR
    • G protein-coupled receptor SALPR
    • G-protein coupled receptor GPCR135
    • GPCR 135
    • GPCR135
    • Gprotein coupled receptor SALPR
    • Relaxin 3 receptor 1
    • Relaxin 3 receptor1
    • Relaxin 3/INSL7 receptor 1
    • Relaxin 3/INSL7 receptor1
    • Relaxin family peptide receptor 3
    • Relaxin family peptide receptor3
    • Relaxin-3 receptor 1
    • Relaxin/insulin like family peptide receptor 3
    • Relaxin3 receptor 1
    • Relaxin3 receptor1
    • RL3 R1
    • RL3R 1
    • RL3R1
    • RL3R1_HUMAN
    • RLN3 receptor 1
    • RLN3 receptor1
    • RLN3R1
    • RXFP3
    • RXFPR3
    • SALP R
    • SALPR
    • somatostatin and angiotensin like peptide receptor
    • Somatostatin- and angiotensin-like peptide receptor
    see all
  • Function
    Receptor for RNL3/relaxin-3. Binding of the ligand inhibit cAMP accumulation.
  • Tissue specificity
    Expressed predominantly in brain regions. Highest expression in substantia nigra and pituitary, followed by hippocampus, spinal cord, amygdala, caudate nucleus and corpus callosum, quite low level in cerebellum. In peripheral tissues, relatively high levels in adrenal glands, low levels in pancreas, salivary gland, placenta, mammary gland and testis.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab162494 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162494 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162494.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up