Overview

  • Product name

    Recombinant Human REM/GES protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      SIADRGSFESASELRIQLRRTHQADHVPIILVGNKADLARCREVSVEEGR ACAVVFDCKFIETSATLQHNVAELFEGVVRQLRLRRRDSA
    • Amino acids

      162 to 251
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162180 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as REM

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • E030011C07Rik
    • GD:REM
    • GES
    • GTP binding protein REM
    • GTP binding protein REM 1
    • GTP binding protein REM1
    • GTP-binding protein REM 1
    • GTPase GES
    • GTPase regulating endothelial cell sprouting
    • GTPase-regulating endothelial cell sprouting
    • MGC114556
    • MGC48669
    • OTTMUSP00000016855
    • Rad and Gem like GTP binding protein 1
    • Rad and Gem-like GTP-binding protein 1
    • RAS (RAD and GEM) like GTP binding
    • RAS like GTP binding
    • RAS like GTP binding protein REM
    • REM 1
    • Rem1
    • REM1_HUMAN
    • RP23-35I8.9
    see all
  • Function

    Promotes endothelial cell sprouting and actin cytoskeletal reorganization. May be involved in angiogenesis. May function in Ca(2+) signaling.
  • Tissue specificity

    Most highly expressed in the endothelial lining of the blood vessels in uterus and heart. Lower levels found in spleen, lymph node, kidney and testis. Also found in cells with secretory function such as the islets of Langerhans, lobule/duct epithelium in the breast, bile duct epithelium in the liver, surface epithelium in the endometrial glands of the uterus, colon mucosa and acinar cells in the pancreas and the prostate.
  • Sequence similarities

    Belongs to the small GTPase superfamily. RGK family.
  • Information by UniProt

Images

  • ab162180 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162180 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162180.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up