For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    recombinant-human-renalase-protein-denatured-ab134535.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Neuroscience Neurotransmitter Biogenic Amines Dopamine
Share by email

Recombinant Human Renalase protein (denatured) (ab134535)

  • Datasheet
Submit a review Q&A (1)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

SDS-PAGE - Recombinant Human Renalase protein (denatured) (ab134535)

    Key features and details

    • Expression system: Escherichia coli
    • Purity: > 90% SDS-PAGE
    • Tags: His tag N-Terminus
    • Suitable for: SDS-PAGE

    Description

    • Product name

      Recombinant Human Renalase protein (denatured)
      See all Renalase proteins and peptides
    • Purity

      > 90 % SDS-PAGE.

    • Expression system

      Escherichia coli
    • Accession

      Q5VYX0
    • Protein length

      Full length protein
    • Animal free

      No
    • Nature

      Recombinant
      • Species

        Human
      • Sequence

        MGSSHHHHHHSSGLVPRGSHMGSMALLRRQTSGPLYLAVWDKAEDSGGRM TTACSPHNPQCTADLGAQYITCTPHYAKKHQRFYDELLAYGVLRPLSSPI EGMVMKEGDCNFVAPQGISSIIKHYLKESGAEVYFRHRVTQINLRDDKWE VSKQTGSPEQFDLIVLTMPVPEILQLQGDITTLISECQRQQLEAVSYSSR YALGLFYEAGTKIDVPWAGQYITSNPCIRFVSIDNKKRNIESSEIGPSLV IHTTVPFGVTYLEHSIEDVQELVFQQLENILPGLPQPIATKCQKWRHSQV TNAAANCPGQMTLHHKPFLACGGDGFTQSNFDGCITSALCVLEALKNYI
      • Predicted molecular weight

        39 kDa including tags
      • Amino acids

        18 to 342
      • Tags

        His tag N-Terminus

    Associated products

    • Related Products

      • Anti-6X His tag® antibody [HIS.H8] (ab18184)
      • Anti-Renalase antibody (ab31291)
      • Anti-6X His tag® antibody [4D11] (ab5000)
      • Anti-6X His tag® antibody (ab9108)

    Specifications

    Our Abpromise guarantee covers the use of ab134535 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    • Applications

      SDS-PAGE

    • Form

      Liquid
    • Concentration information loading...

    Preparation and Storage

    • Stability and Storage

      Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

      pH: 8.00
      Constituents: 12.01% Urea, 0.32% Tris HCl, 10% Glycerol (glycerin, glycerine)

    General Info

    • Alternative names

      • 6530404N21Rik
      • AI452315
      • AW060440
      • C10orf59
      • Chromosome 10 open reading frame 59
      • FLJ11218
      • HGNC:25641
      • Hypothetical protein LOC55328
      • MAO C
      • MAO-C
      • mMAO C
      • Monoamine oxidase C
      • Monoamine oxidase-C
      • Renalase
      • Renalase FAD dependent amine oxidase
      • RNLS
      • RNLS_HUMAN
      see all
    • Function

      Probable FAD-dependent amine oxidase secreted by the kidney, which circulates in blood and modulates cardiac function and systemic blood pressure. Degrades catecholamines such as dopamine, norepinephrine and epinephrine in vitro. Lowers blood pressure in vivo by decreasing cardiac contractility and heart rate and preventing a compensatory increase in peripheral vascular tone, suggesting a causal link to the increased plasma catecholamine and heightened cardiovascular risk. High concentrations of catecholamines activate plasma renalase and promotes its secretion and synthesis (By similarity). According to PubMed:17385068, is unlikely that renalase has physiologically relevant catecholamine-oxidizing activity.
    • Tissue specificity

      Secreted into the blood by the kidney. Highly expressed in the kidney, expressed at lower level in heart, skeletal muscle and small intestine. Its plasma concentration is markedly reduced in patients with end-stage renal disease, as compared with healthy subjects.
    • Sequence similarities

      Belongs to the renalase family.
    • Cellular localization

      Secreted.
    • Target information above from: UniProt accession Q5VYX0 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt

    Images

    • SDS-PAGE - Recombinant Human Renalase protein (denatured) (ab134535)
      SDS-PAGE - Recombinant Human Renalase protein (denatured) (ab134535)
      15% SDS-PAGE analysis of 3 µg ab134535.

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab134535? Please let us know so that we can cite the reference in this datasheet.

    ab134535 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    Question

    Hello
    I would like to know if mentioned peptide is enough (in length) for a posotive control for Human Renalase Affinity Purified Polyclonal Ab (AF5350) from R&D? What about the remaining renelase peptides in your assortment-could they be of any use for such applicaton?

    Read More

    Abcam community

    Verified customer

    Asked on Dec 17 2012

    Answer

    Thank you for contacting us.

    As a suitable positive control for an anti-human renalase antibody, I would recommend the following product catalogue reference number ab134535 : Renalase protein (His tag), https://www.abcam.com/ab134535.

    The peptide ab45730 is only 10 amino acids long and can be used as a specific blocking peptide for the Abcam Renalase antibody catalogue reference number ab31291.

    I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

    Read More

    Abcam Scientific Support

    Answered on Dec 17 2012

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.