Description

  • Product name

    Recombinant Human Renin Receptor protein (His tag)
    See all Renin Receptor proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      NEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVG NLFHRPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSL FSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLS SLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLEL AGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTV KSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIA LALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD
    • Predicted molecular weight

      42 kDa including tags
    • Amino acids

      17 to 350
    • Tags

      His tag N-Terminus
    • Additional sequence information

      N-terminal 6xHis-tagged. Full length mature chain without signal peptide.

Specifications

Our Abpromise guarantee covers the use of ab235066 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein target previously labeled as POU3F2.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • APT6M8 9
    • APT6M8-9
    • ATP6AP2
    • ATP6IP2
    • ATP6M8-9
    • ATPase H(+)-transporting lysosomal accessory protein 2
    • ATPase H(+)-transporting lysosomal-interacting protein 2
    • ATPase H+ transporting lysosomal accessory protein 2
    • ATPase H+ transporting lysosomal interacting protein 2
    • ATPase H+ transporting lysosomal vacuolar proton pump membrane sector associated protein M8 9
    • ATPase membrane sector associated protein M8 9
    • ATPase, H+ transporting, lysosomal (vacuolar proton pump) membrane sector associated protein M8 9
    • CAPER
    • ELDF10
    • Embryonic liver differentiation factor 10
    • ER localized type I transmembrane adaptor
    • ER-localized type I transmembrane adaptor
    • HT028
    • M8 9
    • M8-9
    • MGC99577
    • MRXE
    • MSTP009
    • N14F
    • Renin receptor
    • Renin/prorenin receptor
    • RENR_HUMAN
    • V ATPase M8 9 subunit
    • V ATPase M8.9 subunit
    • V-ATPase M8.9 subunit
    • Vacuolar ATP synthase membrane sector associated protein M8 9
    • Vacuolar ATP synthase membrane sector-associated protein M8-9
    • vacuolar proton ATP synthase membrane sector associated protein M8 9
    • XMRE
    see all
  • Function

    Functions as a renin and prorenin cellular receptor. May mediate renin-dependent cellular responses by activating ERK1 and ERK2. By increasing the catalytic efficiency of renin in AGT/angiotensinogen conversion to angiotensin I, it may also play a role in the renin-angiotensin system (RAS).
  • Tissue specificity

    Expressed in brain, heart, placenta, liver, kidney and pancreas. Barely detectable in lung and skeletal muscles. In the kidney cortex it is restricted to the mesangium of glomeruli. In the coronary and kidney artery it is expressed in the subendothelium, associated to smooth muscles where it colocalizes with REN. Expressed in vascular structures and by syncytiotrophoblast cells in the mature fetal placenta.
  • Involvement in disease

    Defects in ATP6AP2 are a cause of mental retardation X-linked with epilepsy (MRXE) [MIM:300423]. MRXE is a syndromic mental retardation. Patients manifest mild to moderate mental retardation associated with epilepsy, delays in motor milestones and speech acquisition in infancy.
  • Post-translational
    modifications

    Phosphorylated.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • ab235066 analyzed by (Tris-Glycine gel) discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

References

ab235066 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235066.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up