Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MADNLPTEFDVVIIGTGLPESILAAACSRSGQRVLHIDSRSYYGGNWASF SFSGLLSWLKEYQQNNDIGEESTVVWQDLIHETEEAITLRKKDETIQHTE AFCYASQDMEDNVEEIGALQKNPSLGVSNTFTEVLDSALPEESQLSYFNS DEMPAKHTQKSDTEISLEVTDVEESVEKEKYCGDKTCMHTVSDKDGDKDE SKSTVEDKADEPIRNRITYSQIVKEGRRFNIDLVSKLLYSQGLLIDLLIK SDVSRYVEFKNVTRILAFREGKVEQVPCSRADVFNSKELTMVEKRMLMKF LTFCLEYEQHPDEYQAFRQCSFSEYLKTKKLTPNLQHFVLHSIAMTSESS CTTIDGLNATKNFLQCLGRFGNTPFLFPLYGQGEIPQGFCRMCAVFGGIY CLRHKVQCFVVDKESGRCKAIIDHFGQRINAKYFIVEDSYLSEETCSNVQ YKQISRAVLITDQSILKTDLDQQTSILIVPPAEPGACAVRVTELCSSTMT CMKDTYLVHLTCSSSKTAREDLESVVKKLFTPYTETEINEEELTKPRLLW ALYFNMRDSSGISRSSYNGLPSNVYVCSGPDCGLGNEHAVKQAETLFQEI FPTEEFCPPPPNPEDIIFDGDDKQPEAPGTNNVVMAKLESSEESKNLESP EKHLQN
    • Amino acids
      1 to 656
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158110 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as CHML.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CHM like
    • Chml
    • Choroideraemia like protein
    • Choroideraemia-like protein
    • Choroideremia like
    • Choroideremia like (Rab escort protein 2)
    • Choroideremia like protein
    • Rab escort protein 2
    • Rab proteins geranylgeranyltransferase component A 2
    • RAE2_HUMAN
    • REP 2
    • REP-2
    • REP2
    see all
  • Function
    Binds unprenylated Rab proteins, presents it to the catalytic Rab GGTase dimer, and remains bound to it after the geranylgeranyl transfer reaction. The component A is thought to be regenerated by transferring its prenylated Rab back to the donor membrane. Less effective than REP-1 in supporting prenylation of Rab3 family.
  • Sequence similarities
    Belongs to the Rab GDI family.
  • Information by UniProt

Images

  • ab158110 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158110 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158110.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up