Description

  • Product name

    Recombinant Human Repulsive Guidance Molecule A protein (His tag)
    See all Repulsive Guidance Molecule A proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    The purity of ab196086 is greater than 95%, as determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MNHKVHHHHHHMPHLRTFTDRFQTCKVQGAWPLIDNNYLNVQVTNTPVLP GSAATATSKLTIIFKNFQECVDQKVYQAEMDELPAAFVDGSKNGGDKHGA NSLKITEKVSGQHVEIQAKYIGTTIVVRQVGRYLTFAVRMPEEVVNAVED WDSQGLYLCLRGCPLNQQIDFQAFHTNAEGTGARRLAAASPAPTAPETFP YETAVAKCKEKLPVEDLYYQACVFDLLTTGDVNFTLAAYYALEDVKMLHS NKDKLHLYER TRDLPG
    • Predicted molecular weight

      30 kDa including tags
    • Amino acids

      169 to 422
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab196086 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C.

    pH: 7.40
    Constituents: 0.02% DTT, 99% PBS

    0.2 µM filtered solution

General Info

  • Alternative names

    • Repulsive guidance molecule A
    • RGM
    • RGM domain family member A
    • RGMA
    • RGMA_HUMAN
    see all
  • Function

    Member of the repulsive guidance molecule (RGM) family that performs several functions in the developing and adult nervous system. Regulates cephalic neural tube closure, inhibits neurite outgrowth and cortical neuron branching, and the formation of mature synapses. Binding to its receptor NEO1/neogenin induces activation of RHOA-ROCK1/Rho-kinase signaling pathway through UNC5B-ARHGEF12/LARG-PTK2/FAK1 cascade, leading to collapse of the neuronal growth cone and neurite outgrowth inhibition. Furthermore, RGMA binding to NEO1/neogenin leads to HRAS inactivation by influencing HRAS1-PTK2/FAK1-AKT1 pathway. It also functions as a bone morphogenetic protein (BMP) coreceptor that may signal through SMAD1, SMAD5, and SMAD8.
  • Sequence similarities

    Belongs to the repulsive guidance molecule (RGM) family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

References

ab196086 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196086.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up