Recombinant human Ret + PRKAR1A protein (ab204148)

Overview

  • Product name

    Recombinant human Ret + PRKAR1A protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Baculovirus infected Sf9 cells
  • Amino Acid Sequence 1
    • Accession
    • Species

      Human
    • Sequence

      MESGSTAASEEARSLRECELYVQKHNIQALLKDSIVQLCTARPERPMAFL REYFERLEKEEAKQIQNLQKAGTRTDSREDEISPPPPNPVVKGRRRRGAI SAEVYTEEDAASYVRKVIPKDYKTMAALAKAIEKNVLFSHLDDNERSDIF DAMFSVSFIAGETVIQQGDEGDNFYVIDQGETDVYVNNEWATSVGEGGSF GELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILM

      EDPKWEFPRKNLVLGKTLGEGEFGKVVKATAFHLKGRAGYTTVAVKML KENASPSELRDLLSEFNVLKQVNHPHVIKLYGACSQDGPLLLIVEYAKYG SLRGFLRESRKVGPGYLGSGGSRNSSSLDHPDERALTMGDLISFAWQISQ GMQYLAEMKLVHRDLAARNILVAEGRKMKISDFGLSRDVYEEDSYVKRSQ GRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPYPGIPPERL FNLLKTGHRMERPDNCSEEMYRLMLQCWKQEPDKRPVFADISKDLEKMMV KRRDYLDLAASTPSDSLIYDDGLSEEETPLVDCNNAPLPRALPSTWIENK LYGRISHAFTRF
    • Molecular weight

      105 kDa including tags
    • Amino acids

      1 to 236
    • Tags

      GST tag N-Terminus
    Amino Acid Sequence 2
    • Accession
    • Species

      Human
    • Amino acids

      713 to 1114

Specifications

Our Abpromise guarantee covers the use of ab204148 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Specific activity is 280 nmol/min/mg.

  • Applications

    Functional Studies

    SDS-PAGE

  • Purity

    > 85 % Densitometry.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.5
    Constituents: 0.79% Tris HCl, 25% Glycerol, 0.87% Sodium chloride, 0.002% PMSF, 0.004% DTT, 0.307% Glutathione, 0.003% EDTA

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • ACRDYS1
    • ADOHR
    • cadherin family member 12
    • cadherin-related family member 16
    • cAMP-dependent protein kinase regulatory subunit RIalpha
    • cAMP-dependent protein kinase type I-alpha regulatory chain
    • cAMP-dependent protein kinase type I-alpha regulatory subunit
    • CAR
    • Carney complex type 1
    • CDHF12
    • CDHR16
    • CNC
    • CNC1
    • HSCR1
    • hydroxyaryl-protein kinase
    • MEN2A
    • MEN2B
    • MTC1
    • PKR1
    • PPNAD1
    • PRKAR1
    • protein kinase A type 1a regulatory subunit
    • protein kinase, cAMP-dependent, regulatory, type I, alpha
    • proto-oncogene c-Ret
    • proto-oncogene tyrosine-protein kinase receptor Ret
    • PTC
    • rearranged during transfection
    • receptor tyrosine kinase
    • ret proto-oncogene
    • ret proto-oncogene (multiple endocrine neoplasia and medullary thyroid carcinoma 1, Hirschsprung disease)
    • RET receptor tyrosine kinase
    • RET transforming sequence
    • RET-ELE1
    • RET51
    • tissue-specific extinguisher 1
    • TSE1
    see all
  • Relevance

    Receptor tyrosine-protein kinase involved in numerous cellular mechanisms including cell proliferation, neuronal navigation, cell migration, and cell differentiation upon binding with glial cell derived neurotrophic factor family ligands. Phosphorylates PTK2/FAK1. Regulates both cell death/survival balance and positional information. Required for the molecular mechanisms orchestration during intestine organogenesis; involved in the development of enteric nervous system and renal organogenesis during embryonic life, and promotes the formation of Peyer's patch-like structures, a major component of the gut-associated lymphoid tissue. Modulates cell adhesion via its cleavage by caspase in sympathetic neurons and mediates cell migration in an integrin (e.g. ITGB1 and ITGB3)-dependent manner. Involved in the development of the neural crest. Active in the absence of ligand, triggering apoptosis through a mechanism that requires receptor intracellular caspase cleavage. Acts as a dependence receptor; in the presence of the ligand GDNF in somatotrophs (within pituitary), promotes survival and down regulates growth hormone (GH) production, but triggers apoptosis in absence of GDNF. Regulates nociceptor survival and size. Triggers the differentiation of rapidly adapting (RA) mechanoreceptors. Mediator of several diseases such as neuroendocrine cancers; these diseases are characterized by aberrant integrins-regulated cell migration. RET: Regulatory subunit of the cAMP-dependent protein kinases involved in cAMP signaling in cells.
  • Cellular localization

    Cell Membrane

Images

  • Sample Kinase Activity Plot. ab204148 specific activity was determined to be 280 nmol/min/mg.

  • SDS-PAGE analysis of ab204148. MW 105 KDa.

References

ab204148 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204148.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up