Description

  • Product name

    Recombinant Human Retinal S antigen protein (His tag)
    See all Retinal S antigen proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Yeast
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAASGKTSKSEPNHVIFKKISRDKSVTIYLGNRDYIDHVSQVQPVDGVVL VDPDLVKGKKVYVTLTCAFRYGQEDIDVIGLTFRRDLYFSRVQVYPPVGA ASTPTKLQESLLKKLGSNTYPFLLTFPDYLPCSVMLQPAPQDSGKSCGVD FEVKAFATDSTDAEEDKIPKKSSVRLLIRKVQHAPLEMGPQPRAEAAWQF FMSDKPLHLAVSLNKEIYFHGEPIPVTVTVTNNTEKTVKKIKAFVEQVAN VVLYSSDYYVKPVAMEEAQEKVPPNSTLTKTLTLLPLLANNRERRGIALD GKIKHEDTNLASSTIIKEGIDRTVLGILVSYQIKVKLTVSGFLGELTSSE VATEVPFRLMHPQPEDPAKESYQDANLVFEEFARHNLKDAGEAEEGKRDK NDVDE
    • Predicted molecular weight

      47 kDa including tags
    • Amino acids

      1 to 405
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab226882 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • 48 kDa protein
    • Arrestin
    • Arrestin 1
    • ARRS_HUMAN
    • Retinal S antigen (48 KDa protein)
    • Retinal S-antigen
    • Rod photoreceptor arrestin
    • RP47
    • S antigen
    • S antigen retina and pineal gland (arrestin)
    • S arrestin
    • S-AG
    • S-arrestin
    • SAG
    see all
  • Function

    Arrestin is one of the major proteins of the ros (retinal rod outer segments); it binds to photoactivated-phosphorylated rhodopsin, thereby apparently preventing the transducin-mediated activation of phosphodiesterase.
  • Tissue specificity

    Retina and pineal gland.
  • Involvement in disease

    Defects in SAG are a cause of congenital stationary night blindness Oguchi type 1 (CSNBO1) [MIM:258100]; also known as Oguchi disease. Congenital stationary night blindness is a non-progressive retinal disorder characterized by impaired night vision. CSNBO is an autosomal recessive form associated with fundus discoloration and abnormally slow dark adaptation.
  • Sequence similarities

    Belongs to the arrestin family.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab226882 with 5% enrichment gel and 15% separation gel.

References

ab226882 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab226882.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up