Recombinant Human Retinoblastoma binding protein 6 (ab159317)
- Datasheet
- References
- Protocols
Overview
-
Product nameRecombinant Human Retinoblastoma binding protein 6
See all Retinoblastoma binding protein 6 proteins and peptides -
Protein lengthProtein fragment
Description
-
NatureRecombinant
-
SourceWheat germ
-
Amino Acid Sequence
-
SpeciesHuman
-
SequenceSSGNKLLYILNPPETQVEKEQITGQIDKSTVKPKPQLSHSSRLSSDLTRE TDEAAFEPDYNESDSESNVSVKEEESSGNISKDLKDKIVEKAKESLDTAA VVQVGISRNQ
-
Amino acids1582 to 1691
-
Tagsproprietary tag N-Terminus
-
Specifications
Our Abpromise guarantee covers the use of ab159317 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Western blot
ELISA
-
FormLiquid
-
Additional notesProtein concentration is above or equal to 0.05 mg/ml.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.31% Glutathione, 0.79% Tris HCl
General Info
-
Alternative names
- DKFZp686P0638
- DKFZp761B2423
- E3 ubiquitin-protein ligase RBBP6
see all -
FunctionE3 ubiquitin-protein ligase which promotes ubiquitination of YBX1, leading to its degradation by the proteasome. May play a role as a scaffold protein to promote the assembly of the p53/TP53-MDM2 complex, resulting in increase of MDM2-mediated ubiquitination and degradation of p53/TP53; may function as negative regulator of p53/TP53, leading to both apoptosis and cell growth.
-
Tissue specificityHighly expressed in the placenta and testis. Expressed at lower levels in the brain, heart, kidney, liver and lung. Overexpressed in esophageal cancer.
-
PathwayProtein modification; protein ubiquitination.
-
Sequence similaritiesContains 1 CCHC-type zinc finger.
Contains 1 DWNN domain.
Contains 1 RING-type zinc finger. -
Post-translational
modificationsPhosphorylated upon DNA damage, probably by ATM or ATR. Phosphorylated by NEK6. -
Cellular localizationNucleus > nucleolus. Chromosome. Cytoplasm > cytoskeleton > centrosome. Colocalizes with mitotic chromosomes. Co-localizes with NEK6 in the centrosome.
- Information by UniProt
Images
Datasheets and documents
References
ab159317 has not yet been referenced specifically in any publications.