Description

  • Product name

    Recombinant Human REV3L protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      GTISQYFTTLHCPVCDDLTQHGICSKCRSQPQHVAVILNQEIRELERQQE QLVKICKNCTGCFDRHIPCVSLNCPVLFKLSRVNRELSKAPYLRQLLDQF
    • Amino acids

      2953 to 3052
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159329 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Catalytic subunit of DNA polymerase zeta
    • Polymerase DNA zeta
    • POLZ
    • RAD54 like
    • REV3 yeast homolog like
    • Sez4
    • Yeast homolog of Rev 3
    see all
  • Relevance

    This Product recognizes the catalytic subunit of DNA polymerase zeta a nonessential enzyme that is thought to carry out translation replication and is responsible for virtually all DNA damage-induced mutagenesis and the majority of spontaneous mutagenesis.
  • Cellular localization

    Nuclear

Images

  • ab159329 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

This product has been referenced in:

  • Chen Q  et al. miR-145 Regulates the sensitivity of esophageal squamous cell carcinoma cells to 5-FU via targeting REV3L. Pathol Res Pract N/A:152427 (2019). Read more (PubMed: 31072625) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159329.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up