Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      HGRSGLTKAVKESTITLQQAEYEFLSFVRQQTPPGLCPLAGNSVHEDKKF LDKYMPQFMKHLHYRIIDVSTVKELCRRWYPEEYEFAPKKAASHRALDDI SESIKELQFY
    • Amino acids

      101 to 210
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161862 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 1810038D15Rik
    • AW107347
    • CGI 114
    • DKFZP566E144
    • MGC105914
    • MGC111570
    • mitochondrial
    • Oligoribonuclease
    • Oligoribonuclease, mitochondrial [Precursor]
    • ORN_HUMAN
    • REX2, RNA exonuclease 2 homolog (S. cerevisiae)
    • REXO2
    • RFN
    • RNA exonuclease 2
    • RNA exonuclease 2 homolog
    • SFN
    • Small fragment nuclease
    • Smfn
    see all
  • Function

    3'-to-5' exoribonuclease specific for small oligoribonucleotides. Active on small (primarily
  • Sequence similarities

    Belongs to the oligoribonuclease family.
    Contains 1 exonuclease domain.
  • Cellular localization

    Mitochondrion and Nucleus.
  • Information by UniProt

Images

  • ab161862 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161862 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161862.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up