Overview

  • Product name

    Recombinant Human RFC protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MVPSSPAVEKQVPVEPGPDPELRSWRRLVCYLCFYGFMAQIRPGESFITP YLLGPDKNFTREQVTNEITPVLSYSYLAVLVPVFLLTDYLRYTPVLLLQG LSFVSVWLLLLLGHSVAHMQLMELFYSVTMAARIAYSSYIFSLVRPARYQ RVAGYSRAAVLLGVFTSSVLGQLLVTVGRVSFSTLNYISLAFLTFSVVLA LFLKRPKRSLFFNRDDRGRCETSASELERMNPGPGGKLGHALRVACGDSV LARMLRELGDSLRRPQLRLWSLWWVFNSAGYYLVVYYVHILWNEVDPTTN SARVYNGAADAASTLLGAITSFAAGFVKIRWARWSKLLIAGVTATQAGLV FLLAHTRHPSSIWLCYAAFVLFRGSYQFLVPIATFQIASSLSKELCALVF GVNTFFATIVKTIITFIVSDVRGLGLPVRKQNEELHVASLSLWKSHLRLA ADTLSSEGSSGSGPRSWFLSPTLRAALHGPVCPSEVCPS
    • Molecular weight

      81 kDa
    • Amino acids

      1 to 489

Specifications

Our Abpromise guarantee covers the use of ab152691 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 ug/ul.
    Best use within three months from the date of receipt of this protein.

    Protein previously labeled as SLC19A1.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CHMD
    • FLOT 1
    • FLOT1
    • Folate transporter 1
    • FOLT
    • IFC 1
    • IFC-1
    • IFC1
    • Intestinal folate carrier
    • Intestinal folate carrier 1
    • OTTHUMP00000115459
    • OTTHUMP00000115460
    • Placental folate transporter
    • Reduced folate carrier
    • Reduced folate carrier protein
    • REFC
    • RFC
    • RFC 1
    • RFC1
    • S19A1_HUMAN
    • SLC19A1
    • Solute carrier family 19 member 1
    see all
  • Function

    Transporter for the intake of folate. Uptake of folate in human placental choriocarcinoma cells occurs by a novel mechanism called potocytosis which functionally couples three components, namely the folate receptor, the folate transporter, and a V-type H(+)-pump.
  • Tissue specificity

    Placenta, liver, and to a much smaller extent, in lung.
  • Sequence similarities

    Belongs to the reduced folate carrier (RFC) transporter (TC 2.A.48) family.
  • Post-translational
    modifications

    Heavily glycosylated.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab152691 stained with Coomassie Blue

References

ab152691 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152691.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up