Overview

  • Product name

    Recombinant Human RFC2 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MEVEAVCGGAGEVEAQDSDPAPAFSKAPGSAGHYELPWVEKYRPVKLNEI VGNEDTVSRLEVFAREGNVPNIIIAGPPGTGKTTSILCLARALLGPALKD AMLELNASNDSMTDGAQQALRRTMEIYSKTTRFALACNASDKIIEPIQSR CAVLRYTKLTDAQILTRLMNVIEKERVPYTDDGLEAIIFTAQGDMRQALN NLQSTFSGFGFINSENVFKVCDEPHPLLVKEMIQHCVNANIDEAYKILAH LWHLGYSPEDIIGNIFRVCKTFQMAEYLKLEFIKEIGYTHMKIAEGVNSL LQMAGLLARLCQKTMAPVAS
    • Molecular weight

      61 kDa including tags
    • Amino acids

      1 to 320

Specifications

Our Abpromise guarantee covers the use of ab131908 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • A1
    • A1 40 kDa subunit
    • Activator 1
    • Activator 1 40 kDa subunit
    • Activator 1 subunit 2
    • MGC3665
    • OTTHUMP00000160645
    • OTTHUMP00000160646
    • Replication factor C (activator 1) 2
    • Replication factor C (activator 1) 2 40kDa
    • Replication factor C 2
    • Replication factor C 40 kDa subunit
    • Replication factor C subunit 2
    • RF C 40 kDa subunit
    • RF-C 40 kDa subunit
    • RFC 2
    • RFC 40
    • RFC 40 kDa subunit
    • RFC2
    • RFC2_HUMAN
    • RFC40
    see all
  • Function

    The elongation of primed DNA templates by DNA polymerase delta and epsilon requires the action of the accessory proteins proliferating cell nuclear antigen (PCNA) and activator 1. This subunit binds ATP.
  • Involvement in disease

    Note=RFC2 is located in the Williams-Beuren syndrome (WBS) critical region. WBS results from a hemizygous deletion of several genes on chromosome 7q11.23, thought to arise as a consequence of unequal crossing over between highly homologous low-copy repeat sequences flanking the deleted region.
  • Sequence similarities

    Belongs to the activator 1 small subunits family.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab13190 stained with Coomassie Blue.

References

ab131908 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131908.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up