Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      FINSENVFKVCDEPHPLLVKEMIQHCVNANIDEAYKILAHLWHLGYSPED IIGNIFRVCKTFQMAEYLKLEFIKEIGYTHMKIAEGVNSLLQMAGLLARL CQKTMAPVA
    • Amino acids
      245 to 353
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159330 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • A1
    • A1 40 kDa subunit
    • Activator 1
    • Activator 1 40 kDa subunit
    • Activator 1 subunit 2
    • MGC3665
    • OTTHUMP00000160645
    • OTTHUMP00000160646
    • Replication factor C (activator 1) 2
    • Replication factor C (activator 1) 2 40kDa
    • Replication factor C 2
    • Replication factor C 40 kDa subunit
    • Replication factor C subunit 2
    • RF C 40 kDa subunit
    • RF-C 40 kDa subunit
    • RFC 2
    • RFC 40
    • RFC 40 kDa subunit
    • RFC2
    • RFC2_HUMAN
    • RFC40
    see all
  • Function
    The elongation of primed DNA templates by DNA polymerase delta and epsilon requires the action of the accessory proteins proliferating cell nuclear antigen (PCNA) and activator 1. This subunit binds ATP.
  • Involvement in disease
    Note=RFC2 is located in the Williams-Beuren syndrome (WBS) critical region. WBS results from a hemizygous deletion of several genes on chromosome 7q11.23, thought to arise as a consequence of unequal crossing over between highly homologous low-copy repeat sequences flanking the deleted region.
  • Sequence similarities
    Belongs to the activator 1 small subunits family.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab159330 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159330 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159330.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up