Description

  • Product name

    Recombinant Human RFPL1 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAALFQEASSCPVCSDYLEKPMSLECGCAVCFKCINSLQKEPHGEDLLCC CCSMVSQKNKIRPSWQLERLASHIKELEPKLKKILQMNPRMRKFQVDMTL DADTANNFLLISDDLRSVRSGCITQNRQDLAERFDVSICILGSPRFTCGR HYWEVDVGTSTEWDLGVCRESVHRKGRIHLTTERGFWTVSLRDGSRLSAS TVPLTFLFVDRKLQRVGIFLDMGMQNVSFFDAEGGSHVYTFRSVSAEEPL HLFFAPPSPPNGDKSVLSICPVINPGTTDAPVHPGEAK
    • Amino acids

      1 to 288
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159331 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • MGC132428
    • Ret finger protein-like 1
    • RFPL1
    • RFPL1_HUMAN
    • RING finger protein 78
    • RNF78
    see all
  • Tissue specificity

    Seems to be expressed in prostate and less abundantly in adult brain, fetal liver, and fetal kidney.
  • Sequence similarities

    Contains 1 B30.2/SPRY domain.
    Contains 1 RING-type zinc finger.
  • Information by UniProt

Images

  • ab159331 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159331 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159331.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up