Recombinant Human RFWD3 protein (ab162990)

Overview

  • Product name
    Recombinant Human RFWD3 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      DTGNPICSCQPVHTFFGGPTCKLLTKNAIFQSPENDGNILVCTGDEAANS ALLWDAASGSLLQDLQTDQPVLDICPFEVNRNSYLATLTEKMVHTYKWE
    • Amino acids
      651 to 749
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162990 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BC027246
    • E3 ubiquitin protein ligase RFWD3
    • E3 ubiquitin-protein ligase RFWD3
    • FLJ10520
    • MGC27888
    • RFWD3
    • RFWD3_HUMAN
    • Ring finger and WD repeat domain 3
    • RING finger and WD repeat domain containing protein 3
    • RING finger and WD repeat domain-containing protein 3
    • RING finger protein 201
    • RNF201
    see all
  • Function
    E3 ubiquitin-protein ligase that mediates the ubiquitination of p53/TP53 in the late response to DNA damage, and acts as a positive regulator of p53/TP53 stability, thereby regulating the G1/S DNA damage checkpoint. May act by catalyzing the formation of short polyubiquitin chains on p53/TP53 that are not targeted to the proteasome. In response to ionizing radiation, interacts with MDM2 and enhances p53/TP53 ubiquitination, possibly by restricting MDM2 from extending polyubiquitin chains on ubiquitinated p53/TP53.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Contains 1 RING-type zinc finger.
    Contains 3 WD repeats.
  • Post-translational
    modifications
    Phosphorylated at Ser-46 and Ser-63 upon DNA damage by ATM or ATR. ATM phosphorylation occurs at early times upon DNA damage, while ATR is the major kinase at later times. Phosphorylation by ATM and ATR is required to stabilize p53/TP53.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab162990 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162990 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162990.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up