Overview

  • Product name

    Recombinant Human RFX5 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MAEDEPDAKSPKTGGRAPPGGAEAGEPTTLLQRLRGTISKAVQNKVEGIL QDVQKFSDNDKLYLYLQLPSGPTTGDKSSEPSTLSNEEYMYAYRWIRNHL EEHTDTCLPKQSVYDAYRKYCESLACCRPLSTANFGKIIREIFPDIKARR LGGRGQSKYCYSGIRRKTLVSMPPLPGLDLKGSESPEMGPEVTPAPRDEL VEAACALTCDWAERILKRSFSSIVEVARFLLQQHLISARSAHAHVLKAMG LAEEDEHAPRERSSKPKNGLENPEGGAHKKPERLAQPPKDLEARTGAGPL ARGERKKSVVESSAPGANNLQVNALVARLPLLLPRAPRSLIPPIPVSPPI LAPRLSSGALKVATLPLSSRAGAPPAAVPIINMILPTVPALPGPGPGPGR APPGGLTQPRGTENREVGIGGDQGPHDKGVKRTAEVPVSEASGQAPPAKA AKQDIEDTASDAKRKRGRPRKKSGGSGERNSTPLKSAAAMESAQSSRLPW ETWGSGGEGNSAGGAERPGPMGEAEKGAVLAQGQGDGTVSKGGRGPGSQH TKEAEDKIPLVPSKVSVIKGSRSQKEAFPLAKGEVDTAPQGNKDLKEHVL QSSLSQEHKDPKATPP
    • Molecular weight

      92 kDa including tags
    • Amino acids

      1 to 616

Specifications

Our Abpromise guarantee covers the use of ab131776 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • DNA binding protein RFX 5
    • DNA binding protein RFX5
    • DNA-binding protein RFX5
    • Influences HLA class II expression
    • Regulatory factor X 5
    • Regulatory factor X subunit 5
    • Regulatory factor X, 5 (influences HLA class II expression)
    • RFX 5
    • RFX5
    • Rfx5 protein
    • RFX5_HUMAN
    see all
  • Function

    Activates transcription from class II MHC promoters. Recognizes X-boxes. Mediates cooperative binding between RFX and NF-Y. RFX binds the X1 box of MHC-II promoters.
  • Tissue specificity

    Ubiquitous.
  • Involvement in disease

    Defects in RFX5 are a cause of bare lymphocyte syndrome type 2 (BLS2) [MIM:209920]; also known as hereditary MHC class II deficiency or HLA class II-deficient combined immunodeficiency. BLS2 is a severe combined immunodeficiency disease with early onset. It is characterized by a profound defect in constitutive and interferon-gamma induced MHC II expression, absence of cellular and humoral T-cell response to antigen challenge, hypogammaglobulinemia and impaired antibody production. The consequence include extreme susceptibility to viral, bacterial and fungal infections.
  • Sequence similarities

    Belongs to the RFX family.
    Contains 1 RFX-type winged-helix DNA-binding domain.
  • Domain

    The N-terminus is required for dimer formation, association with RFXANK and RFXAP, assembly of the RFX complex, and for binding of this complex to its X box target site in the MHC-II promoter. The C-terminus mediates cooperative binding between the RFX complex and NF-Y.
  • Post-translational
    modifications

    Phosphorylated.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab131776 stained with Coomassie Blue.

References

ab131776 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131776.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up