Overview

  • Product name
    Recombinant Human RFX6 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAKVPKLEDTFLQAQPAPQLSPGIQEDCCVQLLGKGLLVYPEETVYLAAE GQPGGEQGGGEKGEDPELPGAVKSEMHLNNGNFSSEEEDADNHDSKTKAA DQYLSQKKTITQIVKDKKKQTQLTLQWLEENYIVCEGVCLPRCILYAHYL DFCRKEKLEPACAATFGKTIRQKFPLLTTRRLGTRGHSKYHYYGIGIKES SAYYHSVYSGKGLTRFSGSKLKNEGGFTRKYSLSSKTGTLLPEFPSAQHL VYQGCISKDKVDTLIMMYKTHCQCILDNAINGNFEEIQHFLLHFWQGMPD HLLPLLENPVIIDIFCVCDSILYKVLTDVLIPATMQEMPESLLADIRNFA KNWEQWVVSSLENLPEALTDKKIPIVRRFVSSLKRQTSFLHLAQIARPAL FDQHVVNSMVSDIERVDLNSIGSQALLTISGSTDTESGIYTEHDSITVFQ ELKDLLKKNATVEAFIEWLDTVVEQRVIKTSKQNGRSLKKRAQDFLLKWS FFGARVMHNLTLNNASSFGSFHLIRMLLDEYILLAMETQFNNDKEQELQN LLDKYMKNSDASKAAFTASPSSCFLANRNKGSMVSSDAVKNESHVETTYL PLPSSQPGGLGPALHQFPAGNTDNMPLTGQMELSQIAGHLMTPPISPAMA SRGSVINQGPMAGRPPSVGPVLSAPSHCSTYPEPIYPALPQANHDFYSTS SNYQTVFRAQPHSTSGLYPHHTEHGRCMAWTEQQLSRDFFSGSCAGSPYN SRPPSSYGPSLQAQDSHNMQFLNTGSFNFLSNTGAASCQGATLPPNSPNG YYGSNINYPESHRLGSMVNQHVSVISSIRSLPPYSDIHDPLNILDDSGRK QTSSFYTDTSSPVACRTPVLASSLQTPIPSSSSQCMYGTSNQYPAQETLD SHGTSSREMVSSLPPINTVFMGTAAGGT
    • Amino acids
      1 to 928
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165992 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as RFXDC1. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DNA binding protein RFX6
    • Regulatory factor X domain containing protein 1
    • RFX6
    • RFX6 regulatory factor X, 6
    • RFXDC1
    see all
  • Relevance
    RFX6 belongs to the RFX family, which encodes transcription factors that contain a highly-conserved winged helix DNA binding domain.
  • Cellular localization
    Nucleus

Images

  • ab165992 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165992 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165992.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up