Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MELTQPAEDLIQTQQTPASELGDPEDPGEEAADGSDTVVLSLFPCTPEPV NPEPDASVSSPQAGSSLKHSTTLTNRQRGNEVSALPATLD
    • Amino acids
      1 to 90
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160118 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ANKRA1
    • Ankyrin repeat containing regulatory factor X associated protein
    • Ankyrin repeat family A protein 1
    • BLS
    • DNA-binding protein RFXANK
    • F14150_1
    • MGC138628
    • Regulatory factor X associated ankyrin containing protein
    • Regulatory factor X subunit B
    • Regulatory factor X, ankyrin repeat containing
    • Regulatory factor X-associated ankyrin-containing protein
    • RFX Bdelta4
    • RFX-B
    • RFXANK
    • RFXB
    • RFXB delta 4
    • RFXK_HUMAN
    see all
  • Function
    Activates transcription from class II MHC promoters. Activation requires the activity of the MHC class II transactivator (MHC2TA). May regulate other genes in the cell. RFX binds the X1 box of MHC-II promoters. Isoform RFX-B-delta5 is not involved in the positive regulation of MHC class II genes.
  • Tissue specificity
    Ubiquitous.
  • Involvement in disease
    Defects in RFXANK are a cause of bare lymphocyte syndrome type 2 (BLS2) [MIM:209920]; also known as hereditary MHC class II deficiency or HLA class II-deficient combined immunodeficiency. BLS2 is a severe combined immunodeficiency disease with early onset. It is characterized by a profound defect in constitutive and interferon-gamma induced MHC II expression, absence of cellular and humoral T-cell response to antigen challenge, hypogammaglobulinemia and impaired antibody production. The consequence include extreme susceptibility to viral, bacterial and fungal infections.
  • Sequence similarities
    Contains 5 ANK repeats.
  • Domain
    The third ankyrin repeat is required for association with the two other RFX subunits; RFX5 and RFXAP.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab160118 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160118 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160118.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up