Overview

  • Product name

    Recombinant Human RG9MTD1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MKAAAREEAKNIKLLETTEEDKQKNFLFLRLWDRNMDIAMGWKGAQAMQF GQPLVFDMAYENYMKRKELQNTVSQLLESEGWNRRNVDPFHIYFCNLKID GALHRELVKRYQEKWDKLLLTSTEKSHVDLFPKDSIIYLTADSPNVMTTF RHDKVYVIGSFVDKSMQPGTSLAKAKRLNLATECLPLDKYLQWEIGNKNL TLDQMIRILLCLKNNGNWQEALQFVPKRKHTGFLEISQHSQEFINRLKKA KT
    • Amino acids

      1 to 252
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162898 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 1300018J16Rik
    • D16Ertd454e
    • EC 2.1.1.-
    • FLJ20432
    • HBV pre S2 trans regulated protein 2
    • MGC118020
    • MGC94708
    • Mitochondrial ribonuclease P protein 1
    • Mitochondrial RNase P protein 1
    • MRPP1
    • NY REN 49 antigen
    • Renal carcinoma antigen NY REN 49
    • RNA (guanine 9) methyltransferase domain containing 1
    • RNA (guanine 9) methyltransferase domain containing protein 1 mitochondrial
    • Rnmtd1
    see all
  • Relevance

    RG9MTD1 functions in mitochondrial tRNA maturation. Part of mitochondrial ribonuclease P, an enzyme composed of MRPP1/RG9MTD1, MRPP2/HSD17B10 and MRPP3/KIAA0391, which cleaves tRNA molecules in their 5'-ends.
  • Cellular localization

    Mitochondrial

Images

  • ab162898 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162898 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162898.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up