Description

  • Product name

    Recombinant Human RGC-32 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MKPPAEDLSDALCEFDAVLADFASPFHERHFHYEEHLERMKRRSSASVSD SSGFSDSESADSLYRNSFSFSDEKLNSPTDSTPALLSATVTPQKAKLGDT KELEAFIADLDKTLASM
    • Amino acids

      1 to 117
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162195 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as C13orf15. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • bA157L14.2
    • C13orf15
    • Chromosome 13 open reading frame 15
    • KIAA0564
    • MGC87338
    • regulator of cell cycle
    • Regulator of cell cycle RGCC
    • Response gene to complement 32
    • Response gene to complement 32 protein
    • RGC 32
    • RGC-32
    • RGC32
    • RGCC
    • RGCC_HUMAN
    see all
  • Relevance

    Function: Modulates the activity of cell cycle-specific kinases. Enhances CDK1 activity. May contribute to the regulation of the cell cycle. May inhibit growth of glioma cells by promoting arrest of mitotic progression at the G2/M transition. Fibrogenic factor contributing to the pathogenesis of renal fibrosis through fibroblast activation. Tissue specificity: Detected in brain, heart and liver (at protein level). Highly expressed in liver, skeletal muscle, kidney and pancreas. Detected at lower levels in heart, brain and placenta. Detected in aorta endothelial cells. Overexpressed in colon, breast, prostate, bladder, lung, and ovarian cancer tissues.
  • Cellular localization

    Cytoplasm. Nucleus. Cytoplasm › cytoskeleton › centrosome. Note: Cytoplasmic in unstimulated cells. Nuclear after activation by complement. Associated with the centrosome during prometaphase and metaphase.

Images

  • ab162195 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162195 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162195.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up